MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.8
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Gene References into Functions
Our findings suggest that CNTF over-expression enhances the protective effects of bone marrow mesenchymal stem cells on retinal pigment epithelium cells, thus indicating subretinal-transplantation of CNTF-bone marrow mesenchymal stem cells may be a promising therapy for blue-light -injured retinaPMID:29564604
Cytokines of the LIF/CNTF family and metabolismPMID:26817395
High hydrostatic pressure enables almost 100% refolding of recombinant human ciliary neurotrophic factor from inclusion bodies at high concentration.PMID:28323167
CNTFR-specific mutants of CNTF have been developed that bind to the CNTFRalpha-LIFRbeta-gp130 receptor.PMID:26187860
Human CNTF expression through lentiviral gene transfer in the rat striatum significantly decreased the levels of neuronal metabolites (N-acetyl-aspartate, N-acetyl-aspartyl-glutamate, and glutamate).PMID:25833344
the biological effects of CNTF on retinoic acid (RA)-predifferentiated SH-SY5Y neuroblastoma cells and the underlying molecular mechanism of this effect were investigated for the first timePMID:25118897
R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.PMID:24802752
In this review, CNTF plays an important role in neurogenesis and differentiation of neural stem cells.PMID:23948898
The levels of expression and secretion of BDNF and CTNF of induced cells were assessed using immunocytochemical, Real-Time polymerase chain reaction, and enzyme linked immunosorbent assay (ELISA).PMID:23944834
CNTF elevated in umbilical cord blood from pre-eclamptic pregnanciesPMID:23654315
CNTF-mediated protection of photoreceptors requires initial activation of the cytokine receptor gp130 in Muller glial cells.PMID:24191003
Report favourable allelic patterns of ACTN3 and CNTF genes on aerobic performance in athletes.PMID:23676962
Data indicate that aspirin increased mRNA and protein expression of CNTF in primary mouse and human astrocytes in a dose- and time-dependent manner.PMID:23653362
we show that the release of CNTF by glial cells is a very powerful stimulus for optic fiber regeneration and retinal ganglion cell survival after optic nerve crushPMID:23194670
Ciliary neurotrophic factor levels were increased in painful PTT only.PMID:22337942
Peptide 6c, corresponding to human CNTF amino acid residues 147-150, induces neurogenesis, neuronal activity and proliferation of immature neurons in the dentate gyrus and improvement of spatial reference memory in mice.PMID:20952820
CNTF's effects on retinal pigment epithelial (RPE) physiologyPMID:21912637
Data show that variants in CNTF were significantly associated with a lower age at onset of the eating disorders.PMID:20219210
The role played by CNTF in retinal cell differentiation and survival in retinal progenitors, is reported.PMID:20428961
Ciliary neurotrophic factor, and related (CNTF), ligands targeting the established CNTF receptor alpha, binds to sortilin with high affinity.PMID:20584990
In women the CNTF polymorphism (odds ratio (OR) = 2.15, 95%CI: 1.27-3.64, p = 0.004) are associated with weight gain.PMID:19833146
Studies indicate that leptin, CNTF, LIF and IL-6 present similar three-dimensional fold structure, interact with related class-I receptors and activate similar intracellular pathways.PMID:19751193
A null mutation in this protein was evaluated for a relationship to disease susceptibility and disease severity in patients with multiple sclerosis.PMID:11857064
Association of a null mutation in the CNTF gene with early onset of multiple sclerosis.PMID:11890844
Early onset of severe familial amyotrophic lateral sclerosis with a SOD-1 mutation: potential impact of CNTF as a candidate modifier gene.PMID:11951178
CTNF binds to the IL-6 receptor and has a role in neuroprotectionPMID:12643274
no evidence found to suggest that ciliary neurotrophic factor is involved in the pathogenesis of pelvic endometriosisPMID:12890930
Constitutive expression of cytokines in brain induces changes in gene expression characteristic of chronic inflammation leading to either temporal weight reduction (CNTF) or severe cachexia (leukemia inhibitory factor).PMID:14715713
Results do not support an effect of the CNTF null allele on body composition, contrary to previous findings.PMID:14747836
findings support the hypothesis that CNTF and leptin engage distinct CNS sites and CNTF possesses inflammatory properties distinct from leptinPMID:15047605
In spite of axokine gene expression in retinal pigment epithelium, no photoreceptor rescue in retinal degeneration mice.PMID:15180291
myogenic lineage-committed human myoblasts can dedifferentiate at a clonal level; CNTF is a novel regulator of skeletal myoblast dedifferentiation via p44/p42 MAPK pathwayPMID:15843428
CNTF negatively regulates phototransduction, which reduces the photoresponsiveness of rods, resulting in lower electroretinogram amplitudes following light stimulus.PMID:17192435
Possible neuroprotective role of CNTF in the optic nerve head.PMID:17563726
We conclude that absence of CNTF does not increase susceptibility for neurodegenerative disorders and confirm that it does not affect onset and course of familial and sporadic ALS.PMID:17651970
Continuous expression of striatal CNTF at the dose mediated by the expression cassette used in this study was detrimental to transgenic mice with Huntington's disease.PMID:18293418
The relative treatment benefit of iloperidone compared with placebo in patients with schizophrenia is enhanced in patients homozygous G/G for the rs1800169 polymorphism of CNTF.PMID:18303965
In vivo and in vitro experiments implicate CNTF as an endogenous regulatory component of dopamine D2-receptor-dependent neurogenesis in the subventricular zone and the dentate gyrus of the hippocampus. (Review)PMID:18524890
CNTF-mediated signaling is a molecular switch for neuronal versus glial differentiation of retinal stem cells/progenitors.PMID:18669911
Ciliary neurotrophic factor, cardiotrophin-like cytokine, and neuropoietin share a conserved binding site on the ciliary neurotrophic factor receptor alpha chainPMID:18728012
PTP-1B constitutes a key divergent element between leptin/insulin and CNTF signaling pathways at the neuronal level.PMID:19008309
Certain SNP patterns in VDR and CNTF genes showed better improvement of parameters associated with the effects of low-resistance training using exercise machines as analyzed by comparison between SNP patterns and factor analysis.PMID:19082510
The results of this study provided further evidence that the production of ciliary neurotrophic factor by Schwann cells is markedly reduced in Charcot-Marie-Tooth type 1A neuropathy.PMID:19525893
Fusion of HIV-1 TAT to CNTF may have modified the CNTF capacity to induce intracellular signaling in hypothalamic neurons.PMID:19573019
The CNTF 1357 G --> A polymorphism explains only a small portion of the variability in the muscle strength response to training in women.PMID:19628720
An interaction between apoE3 and CNTF occurs with both delipidated apeE3 and apoE3 found within a lipoprotein particle in cerebrospinal fluid. This interaction potentiates the survival-promoting activity of CNTF for hippocampal neurons.PMID:9236223