ANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death. Cleaves phospholipid scramblase proteins XKR4, XKR8 and XKR9.; Lacks enzymatic activity.
Gene References into Functions
Pyrin signaling is dispensable for Clostridium difficile infection (CDI) associated intestinal epithelial cells death and for in vivo pathogenesis; C. difficile enterotoxins induce activation of executioner caspases 3/7 via the intrinsic apoptosis pathway indicating that caspase-3/7-mediated intestinal epithelial cells apoptosis is critical for in vivo host defense during early stages of CDI.PMID:30451870
CASP8: rs1045494 (C > T), PIK3R1: rs3756668 (A > G) and CASP7: rs4353229 (T > C), were associated with longer overall survival in limited disease-small cell lung cancer patients after chemoradiotherapyPMID:26988918
Results show that caspase-7 is phosphorylated by PAK2 at S239 which inhibits its activity by two divergent mechanisms prior to and following caspase activation: initial phosphorylation allosterically slows activation by upstream initiator caspases by impeding cleavage at the intersubunit linker and a second phosphorylation site directly blocks substrate binding.PMID:27889207
Caspase-7 regions involved in the interaction with Hsp90 co-chaperone p23 and substrate recognition.PMID:28863261
Study provides evidence that a loss-of-function variant rs10553596 in CASP7 associates with significantly reduced Alzheimer's disease incidence in elder populations.PMID:27358062
Low expression of CASP7 is associated with non-small cell lung cancer.PMID:26307684
Compared with the TT genotype, the rs10787498GT genotype was associated with an increased cervical cancer risk.PMID:25784056
Phosphorylate caspase-7 bu Src at multiple tyrosine sites enhanced its cellular apoptotic effect.PMID:24407236
Potentially functional polymorphisms in the CASP7 gene contribute to gastric adenocarcinoma susceptibility in an eastern Chinese population.PMID:24040159
showed that CASP7 is downregulated in primary prostate tumors and metastatic lesions across multiple data setsPMID:22986525
Genetic variations of CASP7 may modulate overall survival and progress-free survival of patients with advanced non-small cell lung cancer treated with platinum-based chemotherapy.PMID:22441531
genetic polynorphism is associated with the risk of childhood leukemiaPMID:22548721
XIAP does not function as a NEDD8-E3 ligase for caspase-7 in vivoPMID:22584050
Cellular expression of caspase-7 lacking the critical lysine residues resulted in less-efficient PARP and p23 cleavage compared with cells expressing the wild-type peptidase.PMID:22451931
identify serine 118 in the transactivation domain of YY1 as the site of CK2alpha phosphorylation, proximal to a caspase 7 cleavage sitePMID:22184066
Caspase-7 cleaves human TERT at residues E286 and D628 as part of the apoptosis pathway in cultured cells.PMID:21936563
highly expressed PAK2 mediates chemotherapeutic resistance in human breast invasive ductal carcinoma by negatively regulating caspase-7 activityPMID:21555521
The RIPK1 and CASP7 polymorphisms can be considered as possible prognostic markers for survival after curative resection in patients with colorectal cancer.PMID:20567846
Caspase-8 and caspase-7 sequentially mediate proteolytic activation of acid sphingomyelinase in TNF-R1 receptosomes.PMID:21157428
Single Nucleotide Polymorphisms in CASP7 is asspciated with lung cancer.PMID:20661084
caspase 7 cleavage of ORF57 may represent a cellular function against lytic KSHV infectionPMID:20159985
Specifically interfering with caspase-7 activation may hold therapeutic value for the treatment of cancer and inflammatory ailments.PMID:19782763
Pro-CASP7 was detected in mitochondria, cytosol, nucleus, and microsomes of U937 cells. During TPA-induced differentiation, it moved to the mitochondria.PMID:12145703
caspase 9 by itself can activate caspase 7 in the absence of the caspase 3-dependent pathway in TNF-alpha-induced apoptosisPMID:12804035
the N-peptide of caspase 7 serves to physically sequester the caspase-7 zymogen in a cytosolic location that prevents access by upstream activatorsPMID:12824163
our data suggest that the inactivating mutations of the CASPASE-7 gene might lead to the loss of its apoptotic function and contribute to the pathogenesis of some human solid cancersPMID:12970753
caspase-7 is involved earlier than other effector caspases in apoptosisPMID:14583630
cleavage of Claspin by caspase-7 inactivates the Chk1 signaling pathwayPMID:16123041
Caspase 7 activation is a prominent feature in periodontitis-associated tissue injury.PMID:16213496
Promoters of CASP7 genes are modulated by prohibitin.PMID:16918502
AIF overexpression specifically resulted in the activation of caspase-7, thereby amplifying the inhibition of protein synthesis including eIF3g cleavage.PMID:17094969
observation indicates that neither CASP7 nor CASP8 mutation may occur in gastrointestinal lymphomas, and suggests that neither of them may play an important role in the development of gastrointestinal lymphomasPMID:17532763
crystal structures show that the S2 pocket of caspase-7 can accommodate diverse residuesPMID:17697120
A reticulon protein is identified as one out of a selected number of caspase targets during apoptosis and as a novel substrate for Cdk1 and 2.[PMID:18072206
These results revealed that caspase-7 has a novel role during cell cycle progression at mitosis.PMID:18459962
Valosin-containing protein was cleaved by both capspase-7 and caspase-3 in vitro and during apoptosis; degradomic approach to caspase-7 provides new candidate substrates and valuable clues to the specific function of caspase-7 in apoptosisPMID:18596415
CASP7 (caspase 7) rs2227309 SNP was not associated with rheuatoid arthritis (RA) in a European Caucasian population. CASP7 isoforms alpha and beta could have an involvement in the apoptosis process in RAPMID:18785314
Modulation of effector caspase-7 cleavage determines response of breast and lung tumor cell lines to chemotherapy.PMID:19241192
Results show that caspase 7, as an SREBP-1/2 target, can be induced under mevalonate-restricting conditions, which might help overcome its shortage.PMID:19323650
These findings suggest that genetic variants in caspase-3 and caspase-7 may play a role in endometrial cancer susceptibility.PMID:19531679
Dissecting an allosteric switch in caspase-7 using chemical and mutational probes.PMID:19581639
there is an an association between HCV core and HAX-1, which promotes 5-FU mediated p53-dependent caspase-7 activation and hepatocyte growth inhibitionPMID:19605487
Show
More
Hide
All
Subcellular Location
Cytoplasm.
Protein Families
Peptidase C14A family
Tissue Specificity
Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.