NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.8kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Thiol protease involved in a variety of inflammatory processes by proteolytically cleaving other proteins, such as the precursors of the inflammatory cytokines interleukin-1 beta (IL1B) and interleukin 18 (IL18) as well as the pyroptosis inducer Gasdermin-D (GSDMD), into active mature peptides. Plays a key role in cell immunity as an inflammatory response initiator: once activated through formation of an inflammasome complex, it initiates a proinflammatory response through the cleavage of the two inflammatory cytokines IL1B and IL18, releasing the mature cytokines which are involved in a variety of inflammatory processes. Cleaves a tetrapeptide after an Asp residue at position P1. Also initiates pyroptosis, a programmed lytic cell death pathway, through cleavage of GSDMD. In contrast to cleavage of interleukins IL1B and IL1B, recognition and cleavage of GSDMD is not strictly dependent on the consensus cleavage site but depends on an exosite interface on CASP1 that recognizes and binds the Gasdermin-D, C-terminal (GSDMD-CT) part. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive. In apoptotic cells, cleaves SPHK2 which is released from cells and remains enzymatically active extracellularly.; Apoptosis inactive.; Apoptosis inactive.
Gene References into Functions
ABT-737 elicited an anti-atopic dermatitis (AD) activity via suppression of caspase-1 activation in AD in vitro and in vivo models. Therefore, this study provides important information regarding the use of anticancer drugs for controlling allergic inflammatory diseases.PMID:29957081
Cryo-EM structures of ASC and NLRC4 CARD filaments reveal a unified mechanism of nucleation and activation of caspase-1PMID:30279182
The increased expression of NLRP3 and caspase-1 in fetal membrane and placental tissues may be associated with the development of premature rupture of membrane.PMID:29545514
inflammasome activation and pyroptosis in human microglia and ODCs in vitro after exposure to inflammatory stimuli and demonstrate caspase-1 inhibition by the small-molecule inhibitor VX-765 in both cell types. GSDMD inhibition by siRNA transduction suppressed pyroptosis in human microglia.PMID:29895691
Increased production of caspase-1 in the gut-associated lymphoid tissue and peripheral blood of HIV infected patients.PMID:29672590
Low CASP1 expression is associated with prostate cancer.PMID:28388569
These findings confirm the involvement of caspase-1 in non-classical secretion mechanisms and open novel perspectives for the extracellular function of secreted GBP-1.PMID:28272793
this study demonstrates that the G+7/in6A and A10370-G polymorphisms of the CASP1 gene are associated with increased risk of developing acute coronary syndrome in Mexican populationPMID:28456882
After genotype calling and quality control filtering with exclusion of 3 cases and 3 controls, association analysis was performed across 76 directly genotyped SNPs in NLRP1, CARD, and CASP1 genes, adjusting for age, sex, and population stratificationPMID:29438387
Caspase-1 role in pyroptosis in glioma cells.Mir-214 regulates caspase-1 expression in glioma.PMID:28244850
Data show that cyclic stretch activated the nucleotide-binding oligomerization domain-like receptor containing pyrin domain 1 and 3 (NLRP1 and NLRP3) inflammasomes and induced the release of IL-1beta and pyroptosis via a caspase-1-related mechanism in human periodontal ligament cells (HPDLCs).PMID:27626170
Caspase-1 directly cleaves alpha-Synuclein, generating a highly aggregation-prone species in neurons.PMID:27482083
the activation of Rho GTPases by the CNF1 toxin during E. coli-triggered bacteremia leads to a GR1(+)cell-mediated efficient bacterial clearing and improves host survival. Host alarm requires the Caspase-1/IL-1beta signaling axis.PMID:26492464
Nodakenin inhibited the mRNA expression and production of pro-inflammatory cytokines and caspase-1 activationPMID:28407357
sickle red blood cell induced TLR9, NLRP3, Caspase-1, IL-1beta and IL-18 expression and induced IL-1beta, LTB4 and nitrite production in PBMC cultures.PMID:27045344
Data show that the serine protease inhibitor B9 (serpinB9) mediated caspase-1 inhibition regulates IL-1beta release in monocytes.PMID:26992230
study uncovers a novel mechanism of G9A promoting tumor cell growth and invasion by silencing CASP1, and implies that G9A may serve as a therapeutic target in treating Non-small-cell lung cancer.PMID:28383547
Caspase-1 polymorphisms may play a role in Chagas cardiomyopathy development and could serve as markers to identify individuals at higher risk for priority treatment.PMID:28954073
besides its role in the inhibition of the NF-kappaB pathway, NLRC3 interferes with the assembly and activity of the NALP3 inflammasome complex by competing with ASC for pro-caspase-1 bindingPMID:28584053
Data, including data from studies using recombinant fusion forms of GSDMD (gasdermin D), suggest that GSDMD participates in inflammasome-dependent pyroptosis of macrophages in response to various stimuli; this mechanism involves proteolysis of GSDMD by caspase-1 and caspase-11.PMID:28726636
Proteases caspase-1 and caspase-8 have redundant roles in cleaving IL-1beta and promoting osteomyelitis. [review]PMID:27148834
Patients with NLRP1-associated autoinflammation with arthritis and dyskeratosis syndrome had increased systemic CASP1.PMID:27965258
The biochemical function of NLPR3 inflammasomes is to activate caspase-1, which leads to the maturation of interleukin 1 beta and IL-18 and the induction of pyroptosis, a form of cell death. (Review)PMID:27669650
The structure of the human caspase-1 CARD domain (caspase-1(CARD)) filament solved by cryo-electron microscopy.PMID:27043298
Caspase-1-mediated downregulation of PPARgamma was important in the late stage of monocyte-macrophage differentiation; however, PPARgamma protein levels had little effect on the early stage differentiation.PMID:28052562
Inflammasome NLRP3-caspase-1-mediated degradation of smooth muscle cell contractile proteins may contribute to aortic biomechanical dysfunction and aortic aneurysm/dissection development.PMID:28153878
Study demonstrates that the expression of the NLRP3-caspase-1-IL-18 axis is highly expressed in the peripheral blood mononuclear cells of patients with bullous pemphigoid (BP), and correlated with disease activity, suggesting its involvement in the pathogenesis and progression of BP.PMID:27174093
High expression of CASP1 is associated with osteosarcoma.PMID:28000894
This study demonstrated that dysregulated expression of NLRP3-caspase-1-IL-1beta axis was observed in patients with MM, suggesting they might be involved in the pathogenesis of MM.PMID:26146985
The NLRP3/caspase-1/IL-1beta axis is active in cartilaginous endplates of patients with Modic changes and inflammatory cascades can exacerbate the cartilaginous endplate degeneration which may act as a trigger for intervertebral disc degeneration and low back pain.PMID:27146654
High expression of NLRP3, NLRC4, and CASP1 in background non-tumorous liver is significantly correlated with poor prognosis of patients after resection of hepatocellular carcinoma.PMID:28011505
The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media.PMID:26457439
The results indicate that acteoside may act as a regulator of the IL-32 induced immune responses.PMID:26453510
These results suggest that released caspase-1 exists in a unique complex that is functionally stable and protected from immunodepletion whereas cell-extract generated active caspase-1 is rapidly inhibited in the cytosolic milieu.PMID:26599267
Genetic polymorphisms in Nalp3 and caspase-1 may be associated with individual susceptibility to silicosis, especially when the polymorphisms interact with age, cumulative dust exposure, or smoking status.PMID:26496436
In contrast, inhibition of the protease activity of Kgp, RgpA or RgpB increased the human caspase-1-activating potential of wild-type Porphyromonas gingivalis, indicating an inhibitory effect of the collaborative action of gingipains.PMID:25759090
NLRP3 and caspase-1 are expressed in the odontoblast layers in normal human dental pulp tissue, whereas in inflamed pulp tissue, the odontoblast layers are disrupted and dental pulp cells are positive for NLRP3 and caspase-1.PMID:25684031
the rs713875 IBD risk polymorphism increases MTMR3 expression, which modulates pattern recognition receptor (PRR)-induced outcomes, including increased induced caspase-1 activationPMID:26240347
specific caspase cleavage sites in Kaposi's sarcoma-associated herpesvirus latency-associated nuclear antigen function to blunt apoptosis as well as interfere with the caspase-1-mediated inflammasomePMID:26218605
three cofactor independent human monoclonal aPL can induce transcription of NLRP3 and caspase-1 resulting in inflammasome activation specific for NLRP3, which depends fully on activation of endosomal NADPH-oxidase-2 (NOX2) by aPLPMID:25589411
Internalized Cryptococcus neoformans Activates the Canonical Caspase-1 and the Noncanonical Caspase-8 Inflammasomes.PMID:26466953
In patients with HIV, serum CASP1 levels in a group with high CD4 cell counts increased rapidly then decreased within a short time during early HIV-1 infection. In contrast, CASP1 levels in the CD4Low group were increased after 1 year of HIV-1 infection.PMID:25806508
production of 20-kDa IL-1beta may act to limitIL-1beta signaling by reducing the pool of pro-IL-1beta availability for caspase-1 cleavagePMID:26324708
The study shows that A1AT does not inhibit human monocyte caspase-1.PMID:25658455
Data suggest activation of CASP1 (caspase-1) and secretion of IL18 (interleukin 18)/IFNG (interferon-gamma) in mucosal explants of ileum/colon are related to intensity of inflammatory lesions in patients with active, long-standing Crohn's disease.PMID:26168332
Interleukin-1alpha Activity in Necrotic Endothelial Cells Is Controlled by Caspase-1 Cleavage of Interleukin-1 Receptor-2PMID:26324711
the inflammatory CASP1 is linked to several genes involved in cholesterol homeostasis. These correlations resulted in altered GBM (Glioblastoma Multiforme), in particular for CASP1PMID:25330190
caspase 1 was higher in degenerated intervertebral discs than in healthy controls.PMID:25284686
ASC interacts with NALP3 and caspase-1 via different domains.PMID:25567507
Changes in the tertiary structure of mutated pyrin B30.2 domain interrupting the formation of the pyrin-caspase-1 complex are related to the manifestations of Mediterranean familial fever.PMID:26510601
Show
More
Hide
All
Subcellular Location
Cytoplasm. Cell membrane.
Protein Families
Peptidase C14A family
Tissue Specificity
Expressed in larger amounts in spleen and lung. Detected in liver, heart, small intestine, colon, thymus, prostate, skeletal muscle, peripheral blood leukocytes, kidney and testis. No expression in the brain.