Recombinant Human Cell adhesion molecule CEACAM4 (CEACAM4), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CEACAM4
Uniprot NO.
Research Area
Immunology
Alternative Names
CEACAM4; CGM7Carcinoembryonic antigen-related cell adhesion molecule 4; Carcinoembryonic antigen CGM7; Non-specific cross-reacting antigen W236
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
36-155aa
Target Protein Sequence
FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.6kD
Protein Length
Partial
Tag Info
N-terminal His-tagged and C-terminal Myc-tagged/N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
Gene References into Functions
  1. CEACAM4 is expressed in tumor-derived cell lines, and this expression is specific to an medullary thyroid carcinoma derived cell line. PMID:25152032
  2. CEACAM4 has phagocytic function. PMID:25567962

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily, CEA family
Tissue Specificity
Granulocytes.
Database Links

HGNC: 1816

UNIGENE: Hs.12

KEGG: hsa:1089

STRING: 9606.ENSP00000221954

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1