Recombinant Human Cancer/testis antigen 1 (CTAG1A)

In Stock
Code: CSB-MP006125HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$660
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal hFc-Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
CTAG1A
Uniprot NO.
Research Area
Others
Alternative Names
CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-180aa
Target Protein Sequence
MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.1
Protein Length
Full Length
Tag Info
C-terminal hFc-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
PBS, pH 7.4
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Just like other recombinant proteins, the production of this recombinant Human CTAG1A protein began with appropriate cDNA and PCR methods, and then the CTAG1A expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into Mammalian cell for the expression of the recombinant Human CTAG1A protein. C-terminal FC-Myc tag was used in the process. And we finally get the protein of interest with purity of 85%+.

CTAG1A (also called CTAG, CTAG1, ESO1, LAGE2, LAGE2A) is a gene encoding a protein called cancer/testis antigen 1 in human. The protein encoded by this gene is also known as autoimmunogenic cancer/testis antigen NY-ESO-1 (NY-ESO-1),cancer/testis antigen 6.1 (CT6.1) and L antigen family member 2 (LAGE-2). CTAG1A is an identical copy of the CTAG1B gene. The protein encoded by CTAG1A gene is one of the most immunogenic tumor antigens defined to date, because it induces spontaneous humoral and CD8+ T cell responses against NY-ESO-1 in 40%+ to 50%+ of patients with advanced NY-ESO-1–expressing tumors.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Gene References into Functions
  1. Twenty-eight out of 38 cancer specimens exhibited NY-ESO-1 protein expression, 2/38 showed a strong universal (4+) NY-ESO-1 staining, and 9/40 cancer lesions exhibited a strong (4+) staining for survivin. PMID:29058035
  2. A significant association was found between AKAP4 gene expression and metastasis (P-value: 0.045), expression of the CTAG1B (NY-ESO-1) gene was not observed in our cases. PMID:29480665
  3. In 22 melanoma patients with stage III lymph node metastasis, overall survival was significantly higher in the XAGE-1b and NY-ESO-1 double-negative group than in the other groups. PMID:28105694
  4. The present results indicate the strong humoral immune response against NY-ESO-1 in natural human T-cell leukemia virus type 1 infection, irrespective of the clinical status. PMID:28716148
  5. some autoantibodies, such as anti-MAGEA4, anti-CTAG1 or anti-TP53 and their combinations could possibly contribute to the development of cancer early detection tests (not necessarily restricted to gastric cancer) when being combined with other markers. PMID:27140836
  6. High NY-ESO-1 expression is associated with Lung Cancer. PMID:27793776
  7. Results support the potential utility of NY-ESO-1, PRAME, and MAGEA4 as targets for immunotherapy and as ancillary prognostic parameters in synovial sarcomas. PMID:27993576
  8. Data suggest that only a small fraction of HLA-A*02:01- (HA)-binding ESO peptides are immunogenic, namely those that have high peptide-binding strength and peptide/HA complex stability. This study involved comparison of in silico-predicted and observed cytotoxic T-lymphocyte recognition of tumor antigen epitopes in melanoma patients and transgenic/knockout mice. (ESO = tumor antigen NY-ESO-1) PMID:28536262
  9. These data demonstrate that MAGE-A1-, MAGE-A3-, and NY-ESO-1-specific T cells with antigen-specific cytotoxicity can be cultured from healthy donors and patient-derived cells making adoptive immunotherapy with these cytotoxic T lymphocyte feasible. PMID:28677424
  10. Comparing the overall expression of CTAs, a decreased expression of all melanoma-associated antigens (MAGEs) post-treatment and a slightly increased expression of New York esophageal squamous cell carcinoma 1 (NY-ESO-1) was visible. The simultaneous cytoplasmic and nuclear expression of pan-MAGE or MAGE-A3/A4 correlated with reduced treatment-failure-free-survival (TFFS). PMID:27466502
  11. MAGE-A is more highly expressed than NY-ESO-1 in a majority of human malignancies PMID:27070449
  12. These cells were used to target a human lung cancer line that expressed NY-ESO-1. PMID:26324743
  13. regulation of NY-ESO-1 processing by the ubiquitin receptors Rpn10 and Rpn13 as a well as by the standard and immunoproteasome is governed by non-canonical ubiquitination on non-lysine sites. PMID:26903513
  14. CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors. PMID:26191258
  15. Among mesenchymal tumors, myxoid liposarcomas showed the highest positivity for NY-ESO-1 (88%), followed by synovial sarcomas (49%), myxofibrosarcomas (35%), and conventional chondrosarcomas (28%). PMID:25412843
  16. High expression of NY-ESO-1 is associated with Triple-Negative Breast Cancer. PMID:26413775
  17. NY-ESO-1 expression in melanoma was associated with tumor progression, including increased tumor thickness, and with reduced tumor infiltrating lymphocytes. PMID:25954764
  18. NY-ESO-1 is expressed in esophageal adenocarcinomas, Barrett's metaplasia and normal tissues other than germ cells PMID:24744590
  19. NY-ESO-1 cancer antigen expression has a role in immunotherapy in thyroid cancer PMID:24811699
  20. primary autoantibodies against intracellular MM-specific tumor antigens SSX-2 and NY-ESO-1 are rare but functional in multiple myeloma patients after allogeneic stem cell transplantation PMID:25078248
  21. We have also shown that NY-ESO-1 expression may lead to humoral immune response in patients with meningioma. PMID:24777967
  22. NY-ESO-1 tetramer(+) cells were detected concomitantly with high proportions of Treg but were distinct from the latter and displayed characteristics of TH1 effectors. PMID:24777968
  23. neck squamous cell carcinoma patients showing protein expression of MAGE-A family members or NY-ESO-1 represent a subgroup with an extraordinarily poor survival. PMID:24482145
  24. Our observations indicate a tight link of NY-ESO-1 expression to ERG activation PMID:24789172
  25. NY-ESO-1 and SP17 was not significantly associated with a specific histotype, but high-level GAGE expression was more frequent in squamous cell carcinoma. GAGE expression was demonstrated to be significantly higher in stage II-IIIa than stage I NSCLC. PMID:24103781
  26. NY-ESO-1 appears to be a sensitive and a specific marker for myxoid and round cell liposarcoma among mesenchymal myxoid neoplasms. PMID:23599152
  27. Positive results of immunohistostaining were obtained in 16 (35.6%), 7 (15.6%) and 36 (80.0%) samples using MAGE-C1, NY-ESO-1 and Sp17 antibodies, respectively PMID:23923079
  28. study analyzed NY-ESO-1 expression in 222 melanoma specimens including 16 primary and 206 metastatic tumors; results support previous findings showing higher expression of NY-ESO-1 in metastatic (58/206) versus primary (0/16) tumors; results also show epithelioid subtype of melanoma has the highest incidence of NY-ESO-1 expression PMID:24290058
  29. In two non epithelial cancers (glioma and mesothelioma), the epigenetic regulation of the NY-ESO-1 gene requires the sequential recruitment of the HDAC1-mSin3a-NCOR, Dnmt3b-HDAC1-Egr1 and Dnmt1-PCNA-UHRF1-G9a complexes. PMID:23312906
  30. Melanoma patients' humoral immune systems responded to NY-ESO-1 differently in each individual. PMID:23454162
  31. CTAG1B mRNA and protein are overexpressed with high frequency in myxoid and round cell liposarcoma PMID:22936067
  32. High CTAG1 expression and down-regulation of HLA class-I is associated with non-small cell lung cancer. PMID:23645764
  33. NY-ESO-1 is strongly and diffusely expressed in a majority of synovial sarcomas, but only rarely in other mesenchymal lesions. Suggest roles in targeted therapy and differential diagnosis. PMID:22388761
  34. The presence of circulating T cells responding to Melan-A or NY-ESO-1 had strong independent prognostic impact on survival in advanced melanoma. PMID:22529253
  35. Cancer/testis antigens are novel targets of immunotherapy for adult T-cell leukemia/lymphoma. PMID:22323448
  36. Polymeric structure and TLR4 may play important roles in rendering NY-ESO-1 immunogenic and thus serve as a potent molecular adjuvant. NY-ESO-1 thus represents the first example of a cancer/testis antigen PMID:21900253
  37. Integrated NY-ESO-1 immune responses may have predictive value for ipilimumab treatment in patients with advanced metastatic melanoma. PMID:21933959
  38. Primary tumors with and without lymph node metastases showed no significant differences in MAGE-A 3/4 (P=0.672) and NY-ESO-1 (P=0.444) expression PMID:21556122
  39. LAGE-1a and NY-ESO-1 homology cannot be easily exploited in an anti-NY-ESO-1 vaccine given the low frequency of protein expression detected by IHC or serum analysis. PMID:21247062
  40. Report immunohistochemical expression of NY-ESO-1 in renal oncocytoma and chromophobe renal cell carcinoma. PMID:20591578
  41. Most melanoma patients with spontaneous NY-ESO-1-specific responses in this study exhibit spontaneous CD4-positive T cell responses to at least one of the three immunodominant LAGE-1 epitopes. PMID:21131422
  42. A versatile prime-boost vaccine strategy allows the generation of powerful, high-avidity tumor-associated immunodominant NY-ESO-1-transgene specific CD8-positive cytotoxic T cell responses. PMID:20733200
  43. tumor antigen NY-ESO-1 has a role in the immune responses to tumor and self-antigens PMID:20368442
  44. ESO 9V peptide isoform is more efficient in inducing conjugate formation and cytolytic granule polarization than the ESO 9L isoform. PMID:20053942
  45. MAGE-A3/6 and NY-ESO-1 were expressed in 50.0% (66/132) and 18.2% (24/132) of non-small-cell lung carcinomas, respectively. PMID:19795170
  46. High NY-ESO-1 expression is associated with oral squamous cell carcinoma. PMID:20044626
  47. Postvaccine T-cell clones are shown to recognize and lyse NY-ESO-1 expressing tumor cell lines in vitro. PMID:19728336
  48. NY-ESO-1 119-143 is a promiscuous major histocompatibility complex class II T-helper epitope recognized by Th1- and Th2-type tumor-reactive CD4+ T cells. PMID:11782380
  49. NY-ESO-1 is a marker that can be used to follow the early progression of testicular tumorigenesiswhen the tumors express a similar pattern to the cells of origin,although later tumors cease to express NY-ESO-1. PMID:12065688
  50. abilities of human monocyte-derived DCs and DCs derived in vitro from CD34-positive stem cells to present NY-ESO-1 epitopes to MHC class I-restricted cytotoxic T cells PMID:12138174

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
CTAG/PCC1 family
Tissue Specificity
Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in
Database Links

HGNC: 24198

UNIGENE: Hs.534310

KEGG: hsa:1485

STRING: 9606.ENSP00000332602

OMIM: 300156

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products