Abbreviation
Recombinant Human CD226 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
FACS assay shows that Human CD226 can bind to 293F cell overexpressing human CD155.
Alternative Names
(DNAM-1)(DNAM1)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-247aa
Target Protein Sequence
EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
CD226 (DNAM-1) serves as a critical activating receptor on NK cells and T cells, and this recombinant construct covering residues 19–247 encompasses the extracellular immunoglobulin-like domains responsible for engaging its ligand CD155 (PVR). FACS-based validation confirms that this protein binds 293F cells overexpressing human CD155, providing a suitable basis for integrin-ligand binding studies, cell adhesion and spreading assays, and investigations into immune cell trafficking and tumor metastasis. Mammalian cell expression preserves native glycosylation and disulfide-mediated folding, while the C-terminal hFc1-Myc tag facilitates detection and supports antibody development and validation workflows through straightforward capture on Protein A/G surfaces. Purity exceeding 90% by SDS-PAGE paired with endotoxin levels below 1.0 EU/μg satisfies the criteria typically required for cell-based migration and invasion assays where contamination-sensitive immune cells are involved.
