| Code | |
| MSDS | |
| Size | Pls inquire |
| Source | |
| Conjugate | |
| Have Questions? | Leave a Message or Start an on-line Chat |
CSB-MP006255HU1 Recombinant Human C-X-C chemokine receptor type 5 (CXCR5), partial
Could you please provide sequence, pricing, availability and tag information for all available sizes?
Have you received any customer feedback about the activity of this protein?
Which exactly mammalian cells you use for expressing CSB-MP006255HU1, please confirm if you used HEK293Tcell?
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP
Email: support@cusabio.com
Distributors Worldwide