Recombinant Human C-X-C chemokine receptor type 5 (CXCR5), partial

In Stock
Code: CSB-YP006255HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$368
Quantity:
Express system: Yeast
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CXCR5
Uniprot NO.
Research Area
Cancer
Alternative Names
CXC-R5;CXCR-5;Burkitt lymphoma receptor 1;Monocyte-derived receptor 15;MDR-15;CD antigen CD185
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-55aa
Target Protein Sequence
MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFKAVFVP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.4 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cytokine receptor that binds to B-lymphocyte chemoattractant (BLC). Involved in B-cell migration into B-cell follicles of spleen and Peyer patches but not into those of mesenteric or peripheral lymph nodes. May have a regulatory function in Burkitt lymphoma (BL) lymphomagenesis and/or B-cell differentiation.
Gene References into Functions
  1. miR-192 suppresses T follicular helper cell differentiation by targeting CXCR5 in childhood asthma. PMID:29490514
  2. basal CXCR5(+)Th17 cell frequency may indicate underlying differences in disease phenotype between patients and predict ultimate success of TNF inhibitor therapy PMID:28004828
  3. The A allele of rs613791 and G allele of rs523604 located in CXCR5 were observed to be significantly associated with vitiligo in the Chinese Han population. PMID:28551095
  4. These results provide clear evidence that CXCR4- or CCR5-beta-arrestin complexes induce receptor endocytosis and signaling in the absence of G protein coupling and ligand-induced conformational changes of the receptor. PMID:28733085
  5. these findings demonstrate that CXCR5 overexpression increases the ability of MSCs to respond to migratory stimuli and highly intensifies their immunomodulatory effects in vivo. This strategy for enhancing targeted stem/progenitor cell homing may improve the efficacy of MSC-based therapies. PMID:28454789
  6. all three p53 family members mediate the effects of genotoxic stress on the CXCR5 promoter using the same mechanism associated with attenuation of NFkB activity. PMID:29107083
  7. identified the miR-19a/CXCR5 pathway as a candidate p53-induced migration mechanism PMID:28783539
  8. CXCL13/CXCR5 mediated the aggregation of B cells, that directed the aberrant humoral immune responses via the formation of ectopic germinal centers, which suggests a molecular mechanism of neurological damage in neurosyphilis. PMID:28931218
  9. the data demonstrate that CXCR5(+)CD8(+) T cells represent a significant CD8(+) T cell subset in colorectal tumors and have the potential to contribute to antitumor immunity, but their specific roles require further studies in vivo. PMID:28412245
  10. we demonstrate that PKCepsilon cooperates with the loss of the tumor suppressor Pten for the development of prostate cancer in a mouse model. Mechanistic analysis revealed that PKCe overexpression and Pten loss individually and synergistically upregulate the production of the chemokine CXCL13, which involves the transcriptional activation of the CXCL13 gene PMID:28402859
  11. Levels of CXCR5 mRNA and protein levels were up-regulated in brain from temporal lobe epilepsy patients. PMID:27873133
  12. Neoplastic cells of PCSM-TCL are medium- to-large-sized T cells with cerebriform nuclei, which lack the expression of TFH-cell defining chemokine receptor CXCR5. These features are highly distinctive and can be invaluable in separating this rather indolent cutaneous T-cell lymphoid neoplasm from more aggressive lymphomas of TFH-cell phenotype, including primary cutaneous TFH-cell lymphoma and skin involvement of AITL PMID:26928629
  13. CXCR5 expression positively related to the lymph node and distal metastasis, tumor stage and relapse of colorectal cancer. PMID:25726157
  14. In patients with HBV-related hepatocellular carcinoma the phenotype and function of CXCR5+CD45RA-CD4+ T cells were altered. PMID:26517519
  15. HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21. PMID:26818544
  16. Authors demonstrate that CD40 expression upregulates the chemokine receptor CXCR5 and promotes MDSC migration toward and accumulation within cancer. PMID:26462153
  17. down-regulation of CXCR5 inhibited the growth and proliferation of LNCaP cells. PMID:26640404
  18. findings reveal a neuronal/astrocytic interaction in the spinal cord by which neuronally produced CXCL13 activates astrocytes via CXCR5 to facilitate neuropathic pain. PMID:26752644
  19. Circulating CXCR5+CD4+helper T cells in systemic lupus erythematosus patients share phenotypic properties with germinal center follicular helper T cells and promote antibody production. PMID:25654980
  20. study showed that induction of circulating CXCR5+CD4+ Tfh-like subsets can be detected following immunization with HPV vaccines, and potentially be useful as a marker of immunogenicity of vaccines PMID:26333070
  21. A negative correlation between levels of miR-346 and percentages of CD4(+)CXCR5(+) T cells was confirmed in Graves' disease PMID:25666935
  22. IL-33 enhances humoral immunity against chronic hbv infection through activating CD4(+)CXCR5(+) helper-Inducer T-Lymphocytes. PMID:25714983
  23. elevated CXCR5 expression may contribute to abnormal cell survival and migration in breast tumors that lack functional p53. PMID:25786345
  24. our findings suggest that CXCL13-CXCR5 axis promotes the growth, migration, and invasion of colon cancer cells, probably via PI3K/AKT pathway PMID:25476740
  25. After validation in larger patient groups, CXCR5 and CXCL13 may prove useful as biomarkers for nonsmall cell lung carcinoma Correspondingly, blockade of this axis could serve as an effective therapy for nonsmall cell lung carcinoma. PMID:25271023
  26. FANCA-modulated neddylation pathway involved in CXCR5 membrane targeting and cell mobility. PMID:25015289
  27. three SNPs (rs497916, rs3922, rs676925) in CXCR5 and one SNP (rs355687) in CXCL13 were associated with hepatitis B vaccine efficacy PMID:25077417
  28. specific G protein isoforms coupled to CXCR5 in its resting and active states, were identified. PMID:23773523
  29. Expression features of CXCR5 and its ligand, CXCL13 associated with poor prognosis of advanced colorectal cancer PMID:25010623
  30. CD4+CXCR5+ helper T cells may contribute to the pathogenesis of primary Sjogren's syndrome by promoting the maturation of B cells. PMID:24966908
  31. Suggest that platelet-mediated signaling through CXCR5 may be active in vivo during plaque destabilization, enhancing the anti-inflammatory effects of CXCL13. PMID:24732574
  32. healthy controls with rs6421571CT and TT genotypes had higher mRNA and protein levels of CXCR5 than those with wild-type CC genotype specifically in CD4+ T cells PMID:24833093
  33. 11q23.3 with rs4938573 near CXCR5 gene is associated with follicular lymphoma. PMID:25279986
  34. expression of CXCR5 was significantly associated with both stage and lymph node metastasis, but not with tumor size, tumor differentiation grade, or menopausal status of the patient. PMID:24337540
  35. study discovered multiple susceptibility variants for systemic lupus erythematosus in the 11q23.3 region, including variants in/near PHLDB1 (rs11603023), DDX6 (rs638893) and CXCR5 (rs10892301) PMID:24001599
  36. Results provide additional evidence for a role of host genetic variation in CXCR5 in lymphomagenesis, particularly for FL. PMID:23812490
  37. Data suggest the involvement of CD4+ CXCR5+ T cells (circulating follicular helper T cells Tfh) in the pathogenesis and progression of chronic lymphocytic leukemia (CLL). PMID:23807677
  38. Circulating precursor cd4+ T cells expressing CCR7(low)PD-1(high) CXCR5+ indicate T-helper cell activity and promote antibody responses upon antigen re-exposure. PMID:24138884
  39. Human circulating memory T-helper cells expressing PD-1 and CXCR5 are highly functional and correlate with broadly neutralizing HIV antibody responses. PMID:24035365
  40. A single nucleotide polymorphism in CXCR5, rs630923, is associated with genetic risk for multiple sclerosis. PMID:23739915
  41. Polymorphisms in CXCR5 are associated with HIV-associated non-hodgkin B-cell lymphoma. PMID:23250934
  42. Interruption of CXCL13-CXCR5 axis increases upper genital tract pathology and activation of NKT cells following chlamydial genital infection. PMID:23189125
  43. Data indicate that EBI2 expression modulates CXCL13 binding affinity to CXCR5. PMID:22913878
  44. Levels of CXCL13 are increased in carotid atherosclerosis both systemically and within the atherosclerotic lesion. Based on our in vitro findings, we hypothesize a potential plaque stabilizing effects of CXCL13-CXCR5 interaction PMID:22840692
  45. C-X-C chemokine receptor type 5 gene polymorphisms are associated with non-Hodgkin lymphoma. PMID:22707196
  46. The CXCL13-CXCR5 axis is associated with classic determinants of poor prognosis, such as high grade, hormone receptor negativity, and axillary node involvement. PMID:22607768
  47. Sections of the mouse CXCR5 intron significantly align plus/plus with sections of the human intron; the aligned segments are in the same order in mouse as in man and overall cover 13% of the mouse sequence and 17% of the human sequence. PMID:20809769
  48. Data indicate that the percentages of CD4(+)CXCR5(+) TFH in IA patients were positively correlated with AST. PMID:21750724
  49. these results add new information about the CXCL13-CXCR5 axis in neuroblastic tumors and in the crosstalk between neuroblastic and stromal cells. PMID:21642390
  50. Central memory CD4 T cells expressing CXCR5 efficiently induced PC differentiation and Ig secretion, and displayed a different profile in terms of cytokine and costimulatory molecule expression. PMID:21471443

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expression in mature B-cells and Burkitt lymphoma cells.
Database Links

HGNC: 1060

UNIGENE: Hs.113916

KEGG: hsa:643

STRING: 9606.ENSP00000292174

OMIM: 601613

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products