EVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of human mesangial cells (HMC) through a heterotrimeric G-protein signaling pathway. Binds to CCL21. Probably promotes cell chemotaxis response.; Receptor for the C-X-C chemokine CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the proliferation, survival and angiogenic activity of human microvascular endothelial cells (HMVEC) through a cAMP-mediated signaling pathway. Does not promote cell chemotaxis respons. Interaction with CXCL4 or CXCL10 leads to activation of the p38MAPK pathway and contributes to inhibition of angiogenesis. Overexpression in renal cancer cells down-regulates expression of the anti-apoptotic protein HMOX1 and promotes apoptosis.; Mediates the activity of CXCL11.
Gene References into Functions
High CXCR3 expression is associated with invasion and metastasis in tongue squamous cell carcinoma.PMID:29286143
Up-regulated CXCR3 is detectable in the amniotic fluid and associated with the presence of placental lesions consistent with maternal anti-fetal rejection so may serve as a potential marker of spontaneous preterm delivery.PMID:28829757
the expression of chemokine receptors in different peripheral blood T-cell subsets in patients with polymyositis (PM) and dermatomyositis, was examined.PMID:28869080
Results suggest that infiltration of chemokine (C-X-C motif) receptor 3 (CXCR3)-positive plasma cells is a characteristic feature of Hunner type interstitial cystitis (HIC).PMID:27339056
Results of this study indicate that CXCR3 overexpression in GC is associated with increased DC and TIL infiltration and improved OS.PMID:29266971
Following activation with T-cell receptor and co-culture with various concentrations of chrysotile fibers using freshly isolated CD4+ surface CXCR3 positive and negative fractions, the intracellular expression of CXCR3, IFNgamma and IL-17 remained unchanged when co-cultured with chrysotile.PMID:28498408
In conclusion, it seems that decreased expression of CXCR3 and higher expression of CCR6 were associated with HTLV-1 infection, what indicate that these alterations may favor virus dissemination but not disease manifestation.PMID:28206670
Alternatively spliced variant of CXCR3 mediates the metastasis of liver cancer.PMID:26883105
The CXCL4 monomer acts as the minimal active unit for interacting with CXCR3 N-Terminal Sulfated Peptide, and sulfation of N-terminal tyrosine residues on the receptor is important for binding.PMID:28945356
approach has been able to describe the structural events which dynamically characterize the molecular mechanisms involved in the binding of CXCR3 to CXCL11 and the critical role exerted by its N-terminal region in "hunting" and capturing the ligand.PMID:29054054
High CXCR3 expression is associated with chronic lymphocytic leukaemia in comparison to small lymphocytic lymphoma.PMID:29153094
CD4(+)CXCR3(+) T cells are highly enriched in the inflamed mucosa of intestinal bowel disease patients.PMID:26732675
Up-regulation of CXCR3 chemokine and its ligands in bronchoalveolar lavage fluid during organizing pneumonia increases the risk of chronic lung allograft dysfunction after lung transplantation.PMID:28686641
These data suggest that elevated IP-10 levels may impair NK cell function during HIV infection and that IP-10/CXCR3 blocking may be a novel therapeutic strategy in the control and functional cure of HIV.PMID:28465448
Our result showed that CXCR2 expression was correlated with high grade (P = 0.024), advanced stage (P = 0.029) and metastasis (P = 0.018). The log-rank test revealed that high CXCR2 and CXCR3 expressions are related to poorer overall survival (P < 0.001; P < 0.001).PMID:27273823
The percentage of CXCR3(+) CD4(+) TEM cells negatively correlated with the severity of the cutaneous disease in psoriasis patients. Importantly CLA(+) CD4(+) TCM cells expressing CCR6(+) or CCR4(+)CXCR3(+) negatively correlated with psoriasis severity suggesting recruitment to the skin compartment.PMID:28392462
Our studies suggest that CXCR3 is a key contributor to the pathogenesis of Alopecia areata by mediating the infiltration of autoreactive CD8+NKG2D+ T cells into the skinPMID:27412416
TNF-alpha augments CXCR2 and CXCR3 to promote the progression of renal cell carcinoma leading to a poor prognosis.PMID:27297979
TNF-alpha upregulated the expression of CXCR3 in HUVECsPMID:27565063
TLR9 ligands may contribute to the immunopathogenesis of sarcoidosis via induction of CXCL10 release in the alveolar macrophages.PMID:27390897
The CXCL10/CXCR3 axis mediates T-cell recruitment into the skin in progressive vitiligo. Blocking this chemotactic mechanism may present a new form of therapy.PMID:26801009
these data suggest that CXCR3A contributes to the growth, invasion and metastasis of gastric cancer cells in vitro and in vivo, and thus may be a key mediator of gastric cancer progression.PMID:27461521
IP-10 complexes with CXCR3, which in turn activates the ERK1/2 pathway, thus resulting in upregulation of p-CREB and increased vascular smooth muscle cell proliferation.PMID:28111710
the CXCR3+/CCR5+ expression was higher in the neoplastic as compared to the hyperplastic nodules.PMID:27872865
monocytes and lymphocytes cooperate to enhance migration towards CXCR3 chemokines and CCL5 in COPDPMID:26965295
CXCL10/CXCR3 axis promotes gastric cancer cell invasion and migration by upregulating MMP-2 and MMP-9 production via PI3K/AKT pathway.PMID:27470388
CXCR3 expression in chronic lymphocytic leukemia cells was a strong determinant of a worse clinical outcome.PMID:26589908
Speculate that aberrant expression of CXCR3 in marginal zone lymphoma of the skin is associated with migration of lymphoma cells to the epidermis and could lead to an epidermotropic pattern.PMID:26275313
CXCR3 role in autoimmune thyroiditis [review]PMID:24999582
Both CXCL10 and CXCR3 appeared to be useful in differentiating T1R reaction in borderline leprosy while CXCR3 alone differentiated BT from BT-T1RPMID:26831417
CXCR3 expression was upregulated in advanced gastric cancer and was associated with increased CD4+, CD8+ tumor-infiltrating lymphocyte infiltration and improved overall survivalPMID:26823797
CXCR3 was also linked to steatosis through inducing hepatic lipogenic genesPMID:26394162
congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.PMID:26506526
Suggest that aberrant CXCR3 expression may play crucial roles in suppressing prostate carcinoma metastasis by inhibiting cell proliferation and invasion through the PCLbeta signaling pathway.PMID:26339376
The expression of the chemokine receptors CXCR3, CXCR4 and CXCR7 and their ligands.PMID:26037167
This study is aimed at the optimization of a new analytical method for metabolic profiling with parallel bioaffinity assessment of CXCR3 ligands of the azaquinazolinone and piperazinyl-piperidine class and their metabolites.PMID:26164305
CXCR3-A, the predominant form in hematopoietic cells, mediates tumor "go" signaling by promoting cell proliferation, survival, chemotaxis, invasion and metastasis; while CXCR3-B, on epithelial cells, mediates "stop" signalingPMID:25663474
Common variants of CXCR3 and its ligands CXCL10 and CXCL11 are associated with vascular permeability of dengue infection in peninsular Malaysia.PMID:25858769
our study suggested a potential use of CXCR3 overexpression as a prognostic marker for gastric cancerPMID:26434630
CD4+ T cells demonstrated markedly decreased CXCR3 expression.PMID:25768944
Results indicate that CXC chemokine receptors 3 (CXCR3) contributes to spontaneous preterm birth (SPTB).PMID:26209629
High expression of CXCR3 is associated with glioblastoma patients with an invasive phenotype.PMID:25527046
Report crosstalk between TGF-beta1 and CXCR3 signaling in the regulation of urethral fibrosis.PMID:24907118
Expression of CXCR3 in fibroblasts is associated with the expression of IL-13Ralpha2.PMID:25514189
Targeting of both CXCR3 isoforms may be important to block the stem cell-promoting actions of CXCR3-B, while inhibiting the pro-proliferative and metastasis-promoting functions of CXCR3-A.PMID:25537642
CXCR3 has been demonstrated to be strongly related to tumour progression in advanced colorectal cancer.PMID:25232565
CXCR3 and IP-10 are involved in the pathogenesis of bronchiolitis, and CXCR3 is associated with allergic factors.PMID:25760840
Higher percentages of CCR4+ CD4 TEM cells in acute RSV infection were accompanied with higher percentages of CXCR3+ CD8 TEM cells, whereas the development of long-lived memory CXCR3+ CD4 and CD8 TCM cells seems to be compromisedPMID:25013801
the participation of the chemokine CXCL10/CXCR3 axis in celiac disease pathogenesisPMID:24586509
The different groups of clinically stable nonallergic asthmatic patients showed distinct patterns of alterations in subset distribution as well as CCR6, CXCR3, and CCR5 expression on circulating T lymphocytes.PMID:25178112
Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta. Isoform 2 is expressed in endothelial cells. Expressed in T-cells (at protein level).