Home
Product
Protein
Active Protein
Other
Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

In Stock

Code: CSB-MP004848HU

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$558

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human CCR9 protein-VLPs (Active)

Purity

Greater than 95% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU). The EC50 is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control.

Target Names

CCR9

Uniprot NO.

P51686

Research Area

Cancer

Alternative Names

C-C CKR-9; CC-CKR-9; CCR-9;G-protein coupled receptor 28;GPR-9-6

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-369aa

Target Protein Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

43.4 kDa

Protein Length

Full Length

Tag Info

C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.

Storage

Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Shelf Life

The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

CSB-MP004848HU is detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 95% as determined by HPLC-SEC.
Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU)，the EC₅₀ is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control.

Description

CCR9 mediates lymphocyte homing to the small intestine and thymus, making it a critical target for understanding mucosal immunity and T-cell trafficking disorders. This full-length receptor (aa 1–369) is presented in virus-like particles that preserve native membrane topology and post-translational modifications, as confirmed by functional ELISA showing specific binding to anti-CCR9 recombinant antibody with an EC50 of 31.67–36.83 ng/mL. The quantified binding activity supports use in competitive inhibition assays for small-molecule antagonist screening, therapeutic antibody epitope mapping, and ligand-receptor interaction studies by surface plasmon resonance or biolayer interferometry. Purity exceeding 95% by SEC-HPLC and endotoxin levels below 1.0 EU/μg align with standards expected in antibody validation workflows and affinity characterization platforms where conformational integrity is non-negotiable.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

If in the VLP CCR9 protein the His-tag is expose for the detection

The tag of CSB-MP004848HU is C-terminal 10xHis-tagged. The C-terminal of this protein is in the intracellular region, it is inside the VLPs vesicle structure. So the C-terminal 10xHis-tagged is not exposed.
It can't be detected by his tag under non-denaturing conditions. Under denaturing conditions,after destroying the vesicle structure, it can be detected by his tag.

Target Background

Function(From Uniprot)

Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.

Gene References into Functions

There were significantly increased CCR9 protein levels in failing human hearts. PMID:27146447
this study showed that CCR7 are overexpressed in CD4(-) CD8(-) thymocytes of myasthenia gravis patients. PMID:26616645
Results indicated that the expression levels of CCR9 in lesional skin may be a useful biologic marker of the clinical efficacy of infliximab therapy in psoriasis patients. PMID:26507968
Xray crystal structure of the CCR9 receptor in complex with vercirnon at 2.8 A resolution PMID:27926729
It plays a pathogenic role in liver diseases and it will be a therapeutic target of the diseases. PMID:27795503
that CCL25/CCR9 signal may provide cancer cells with chemotactic abilities through influencing several epithelial-mesenchymal transitionmarkers PMID:27008282
Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis. PMID:26879872
CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue. PMID:26348893
CCR9 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group. PMID:26279399
CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway. PMID:25691296
CCR9 could be beneficial in predicting lymph node metastasis, and it might act as a novel prognostic biomarker for lung adenocarcinoma. PMID:26168791
We also show that primary tumors can be modeled in immunocompetent mice by microinjecting CCR9-expressing cancer cell lines into early-stage mouse blastocysts, which induces central immune tolerance PMID:26006007
High CCR9 expression is associated with the pathogenesis of ulcerative colitis. PMID:24936795
Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls. PMID:25296976
activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development. PMID:25710912
The results show the potential of the 91R monoclonal antibody as a therapeutic agent for treatment of CCR9-expressing tumors. PMID:24870448
results suggest that CCR9 can act as a novel prognostic marker and therapeutic target for hepatocellular carcinoma PMID:24481516
CCR9 expression is elevated in the nodal lymphomas of patients with GI involvement PMID:24828696
Only rotavirus specific CD4 T cells expressed intestinal homing receptors alpha4beta7 and CCR9. PMID:24606696
Data suggest that P-glycoprotein associate with the F-actin cytoskeleton through ezrin/radixin/moesin (ERM) in CCR9/CCL25 induced multidrug resistance of acute T-lymphocytic leukemia (T-ALL) cells. PMID:23326330
Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia. PMID:21984373
We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. PMID:21637913
CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion. PMID:21344163
CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive system PMID:21511186
The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization. PMID:21075690
TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells. PMID:20947433
CCR9 expression by monocytes is increased in rheumatoid arthritis PMID:20738854
Results demonstrate enhanced pancreatic intraepithelial neoplasia and pancreatic cancer cell proliferation with activation of CCR9 by its selective ligand CCL25 PMID:19756884
Studies indicate that D6 chemokine receptor(CCR-9) may act as scavenging decoys and are involved in clearance of chemokines. PMID:20036838
more active homing of CCR9-926AG T cells to Peyer's patches may produce changes in Ag presentation and result in increased incidence of skin graft vs. host disease. PMID:19525985
over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis. PMID:20081876
A subset of CCR9+ T cells from normal donors has characteristics of mucosal T cells in terms of activated phenotype, proliferative response to anti-CD2 stimulation, a Th1 or Tr1 cytokine profile, and support for Ig production by cocultured B cells. PMID:12816994
CCR9 selectively induced T-ALL CD4+ T-cell chemotaxis and adhesion. PMID:14559839
High Expression of CCR9 is associated with prostate cancer cell migration and invasion PMID:15623660
involved in the pathogenesis of lymphatic filarial disease PMID:15717282
CCR9 overexpression is associated with Adult T-cell leukemia cells infiltrating gastrointestinal tract PMID:17205512
CCR9 expression is reduced on epithelial and lamina propria T cells in untreated celiac disease. Down-regulation of CCR9 persists in intraepithelial T cells from well-treated patients. Possible ongoing immune activation preferentially within epithelium. PMID:17570212
CCR9 is expressed on human melanoma cells and participates in the enhanced motility of melanoma cells and is likely a "homing receptor" for melanoma to the small bowel. PMID:18245518
Functionally active CCR9 on melanoma cells facilitates metastasis to the small intestine which may explain high incidence of metastis to the small intestine. PMID:18245522