Recombinant Human C-C chemokine receptor type 9 (CCR9)-VLPs (Active)

CSB-MP004848HU
Size:
20ug
20ug100ug1mg
US$558
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10 μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU). The EC50 is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
CCR9
Uniprot NO.
Research Area
Cancer
Alternative Names
C-C CKR-9; CC-CKR-9; CCR-9;G-protein coupled receptor 28;GPR-9-6
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-369aa
Target Protein Sequence
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLLETTSGALSL
Mol. Weight
43.4 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • CSB-MP004848HU is detected by Mouse anti-6*His monoclonal antibody.
  • The purity of VLPs was greater than 95% as determined by HPLC-SEC.
  • Measured by its binding ability in a functional ELISA. Immobilized Human CCR9 at 10μg/mL can bind Anti-CCR9 recombinant antibody (CSB-RA004848MA1HU),the EC50 is 31.67-36.83 ng/mL.The VLPs (CSB-MP3838) is negative control.
Description

The recombinant human CCR9 protein is a mammalian cell-derived virus-like particle (VLP) formulation engineered to present the full-length human C-C chemokine receptor type 9, spanning residues 1-369, with a C-terminal 10xHis tag for purification. Produced as lyophilized powder, this VLP-embedded protein exhibits >95% purity as validated by SEC-HPLC, ensuring monodispersity and structural integrity. Functional characterization via ligand-binding assays demonstrates its capacity to interact specifically with the anti-CCR9 recombinant antibody (CSB-RA004848MA1HU) when immobilized at 10 μg/mL, yielding an effective concentration for half-maximal binding (EC50) between 31.67 and 36.83 ng/mL. The VLP architecture mimics native membrane topology, preserving conformational epitopes critical for studying receptor-ligand interactions and antibody neutralization mechanisms. This particulate presentation system enhances avidity effects while maintaining solubility, making it particularly suitable for vaccine development, immune response profiling, and high-throughput screening of therapeutic candidates targeting chemokine-mediated signaling pathways.

The CCR9 protein, a crucial member of the chemokine receptor family, has emerged as a significant player in the immune response and various cancers. CCR9's primary ligand, CCL25 (thymus-expressed chemokine), directs immune cell migration, particularly impacting T lymphocytes' localization to the intestines and thymus. This homing ability is vital for maintaining immune surveillance and tolerance in the gut, where CCR9+ T cells are preferentially recruited to sites of inflammation or injury, thus influencing local immune responses and potentially contributing to the pathogenesis of autoimmune diseases like Crohn's disease [1][2][3][4].

Functionally, CCR9 has been implicated in regulating T cell development and function. In particular, it is expressed on various T cell subsets, including CD4+ and CD8+ T cells, and plays a critical role in their differentiation and survival through signaling pathways such as PI3K/Akt [3][5]. CCR9+ dendritic cells also contribute to immune modulation, enhancing the immunological tolerance necessary to prevent inappropriate immune responses to commensal gut microbiota and food antigens [2][3].

The expression of CCR9 is not limited to the immune system. It has been shown to play a role in cancer pathology. Overexpression of CCR9 has been associated with increased cell motility and invasiveness in several malignancies, including lung adenocarcinoma, ovarian cancer, and melanoma [6][7][8]. CCR9 is essential for the normal immune function of lymphocytes homing to mucosal sites and also facilitates the metastasis of cancer cells to the intestinal environment. This property is particularly evident in studies demonstrating that CCR9+ tumor cells preferentially migrate to tissues where CCL25 is expressed, suggesting a mechanism for cancer progression and metastasis [7-9].

References:
[1] M. Pathak, P. Padghan, N. Halder, N. Kulkarni, S. Sonar, & G. Lal. Ccr9 signaling in dendritic cells drives the differentiation of foxp3+ tregs and suppresses the allergic ige response in the gut. European Journal of Immunology, vol. 50, no. 3, p. 404-417, 2019. https://doi.org/10.1002/eji.201948327
[2] H. Hadeiba, T. Sato, A. Habtezion, C. Oderup, J. Pan, & E. Butcher. Ccr9 expression defines tolerogenic plasmacytoid dendritic cells able to suppress acute graft-versus-host disease. Nature Immunology, vol. 9, no. 11, p. 1253-1260, 2008. https://doi.org/10.1038/ni.1658
[3] M. Pathak and G. Lal. The regulatory function of ccr9+ dendritic cells in inflammation and autoimmunity. Frontiers in Immunology, vol. 11, 2020. https://doi.org/10.3389/fimmu.2020.536326
[4] L. Airaksinen, J. Cerqueira, et al. Dissecting the contribution of single nucleotide polymorphisms in ccr9 and ccl25 genomic regions to the celiac disease phenotype. Journal of Translational Autoimmunity, vol. 4, p. 100128, 2021. https://doi.org/10.1016/j.jtauto.2021.100128
[5] B. Li, Z. Wang, Y. Zhong, J. Lan, X. Li, & H. Lin. Ccr9–ccl25 interaction suppresses apoptosis of lung cancer cells by activating the pi3k/akt pathway. Medical Oncology, vol. 32, no. 3, 2015. https://doi.org/10.1007/s12032-015-0531-0
[6] Y. Zhong, L. Jiang, et al. Expression of cc chemokine receptor 9 predicts poor prognosis in patients with lung adenocarcinoma. Diagnostic Pathology, vol. 10, no. 1, 2015. https://doi.org/10.1186/s13000-015-0341-x
[7] E. Johnson, R. Singh, et al. Ccl25-ccr9 interaction modulates ovarian cancer cell migration, metalloproteinase expression, and invasion. World Journal of Surgical Oncology, vol. 8, no. 1, 2010. https://doi.org/10.1186/1477-7819-8-62
[8] Z. Zhang, C. Qin, Y. Wu, Z. Su, G. Xian, & B. Hu. Ccr9 as a prognostic marker and therapeutic target in hepatocellular carcinoma, Oncology Reports, vol. 31, no. 4, p. 1629-1636, 2014. https://doi.org/10.3892/or.2014.2998
[9] E. Heinrich, A. Arrington, et al. Paracrine activation of chemokine receptor ccr9 enhances the invasiveness of pancreatic cancer cells. Cancer Microenvironment, vol. 6, no. 3, p. 241-245, 2013. https://doi.org/10.1007/s12307-013-0130-6

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

If in the VLP CCR9 protein the His-tag is expose for the detection

A:

The tag of CSB-MP004848HU is C-terminal 10xHis-tagged. The C-terminal of this protein is in the intracellular region, it is inside the VLPs vesicle structure. So the C-terminal 10xHis-tagged is not exposed.
It can't be detected by his tag under non-denaturing conditions. Under denaturing conditions,after destroying the vesicle structure, it can be detected by his tag.

Target Background

Function
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level.; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
Gene References into Functions
  1. There were significantly increased CCR9 protein levels in failing human hearts. PMID:27146447
  2. this study showed that CCR7 are overexpressed in CD4(-) CD8(-) thymocytes of myasthenia gravis patients. PMID:26616645
  3. Results indicated that the expression levels of CCR9 in lesional skin may be a useful biologic marker of the clinical efficacy of infliximab therapy in psoriasis patients. PMID:26507968
  4. Xray crystal structure of the CCR9 receptor in complex with vercirnon at 2.8 A resolution PMID:27926729
  5. It plays a pathogenic role in liver diseases and it will be a therapeutic target of the diseases. PMID:27795503
  6. that CCL25/CCR9 signal may provide cancer cells with chemotactic abilities through influencing several epithelial-mesenchymal transitionmarkers PMID:27008282
  7. Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis. PMID:26879872
  8. CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue. PMID:26348893
  9. CCR9 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group. PMID:26279399
  10. CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway. PMID:25691296
  11. CCR9 could be beneficial in predicting lymph node metastasis, and it might act as a novel prognostic biomarker for lung adenocarcinoma. PMID:26168791
  12. We also show that primary tumors can be modeled in immunocompetent mice by microinjecting CCR9-expressing cancer cell lines into early-stage mouse blastocysts, which induces central immune tolerance PMID:26006007
  13. High CCR9 expression is associated with the pathogenesis of ulcerative colitis. PMID:24936795
  14. Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls. PMID:25296976
  15. activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development. PMID:25710912
  16. The results show the potential of the 91R monoclonal antibody as a therapeutic agent for treatment of CCR9-expressing tumors. PMID:24870448
  17. results suggest that CCR9 can act as a novel prognostic marker and therapeutic target for hepatocellular carcinoma PMID:24481516
  18. CCR9 expression is elevated in the nodal lymphomas of patients with GI involvement PMID:24828696
  19. Only rotavirus specific CD4 T cells expressed intestinal homing receptors alpha4beta7 and CCR9. PMID:24606696
  20. Data suggest that P-glycoprotein associate with the F-actin cytoskeleton through ezrin/radixin/moesin (ERM) in CCR9/CCL25 induced multidrug resistance of acute T-lymphocytic leukemia (T-ALL) cells. PMID:23326330
  21. Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia. PMID:21984373
  22. We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. PMID:21637913
  23. CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion. PMID:21344163
  24. CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive system PMID:21511186
  25. The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization. PMID:21075690
  26. TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells. PMID:20947433
  27. CCR9 expression by monocytes is increased in rheumatoid arthritis PMID:20738854
  28. Results demonstrate enhanced pancreatic intraepithelial neoplasia and pancreatic cancer cell proliferation with activation of CCR9 by its selective ligand CCL25 PMID:19756884
  29. Studies indicate that D6 chemokine receptor(CCR-9) may act as scavenging decoys and are involved in clearance of chemokines. PMID:20036838
  30. more active homing of CCR9-926AG T cells to Peyer's patches may produce changes in Ag presentation and result in increased incidence of skin graft vs. host disease. PMID:19525985
  31. over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis. PMID:20081876
  32. A subset of CCR9+ T cells from normal donors has characteristics of mucosal T cells in terms of activated phenotype, proliferative response to anti-CD2 stimulation, a Th1 or Tr1 cytokine profile, and support for Ig production by cocultured B cells. PMID:12816994
  33. CCR9 selectively induced T-ALL CD4+ T-cell chemotaxis and adhesion. PMID:14559839
  34. High Expression of CCR9 is associated with prostate cancer cell migration and invasion PMID:15623660
  35. involved in the pathogenesis of lymphatic filarial disease PMID:15717282
  36. CCR9 overexpression is associated with Adult T-cell leukemia cells infiltrating gastrointestinal tract PMID:17205512
  37. CCR9 expression is reduced on epithelial and lamina propria T cells in untreated celiac disease. Down-regulation of CCR9 persists in intraepithelial T cells from well-treated patients. Possible ongoing immune activation preferentially within epithelium. PMID:17570212
  38. CCR9 is expressed on human melanoma cells and participates in the enhanced motility of melanoma cells and is likely a "homing receptor" for melanoma to the small bowel. PMID:18245518
  39. Functionally active CCR9 on melanoma cells facilitates metastasis to the small intestine which may explain high incidence of metastis to the small intestine. PMID:18245522

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the thymus and low in lymph nodes and spleen.
Database Links

HGNC: 1610

UNIGENE: Hs.225946

KEGG: hsa:10803

STRING: 9606.ENSP00000350256

OMIM: 604738

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products