Recombinant Human Butyrophilin-like protein 2 (BTNL2), Partial

Code: CSB-EP883443HUc7
Size:
20ug
20ug100ug1mg
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human BTNL2 protein, partial
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
BTNL2
Uniprot NO.
Research Area
Immunology
Alternative Names
BTL-II
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-455aa
Target Protein Sequence
KQSEDFRVIGPAHPILAGVGEDALLTCQLLPKRTTMHVEVRWYRSEPSTPVFVHRDGVEVTEMQMEEYRGWVEWIENGIAKGNVALKIHNIQPSDNGQYWCHFQDGNYCGETSLLLKVAGLGSAPSIHMEGPGESGVQLVCTARGWFPEPQVYWEDIRGEKLLAVSEHRIQDKDGLFYAEATLVVRNASAESVSCLVHNPVLTEEKGSVISLPEKLQTELASLKVNGPSQPILVRVGEDIQLTCYLSPKANAQSMEVRWDRSHRYPAVHVYMDGDHVAGEQMAEYRGRTVLVSDAIDEGRLTLQILSARPSDDGQYRCLFEKDDVYQEASLDLKVVSLGSSPLITVEGQEDGEMQPMCSSDGWFPQPHVPWRDMEGKTIPSSSQALTQGSHGLFHVQTLLRVTNISAVDVTCSISIPFLGEEKIATFSLSGW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.0 kDa
Protein Length
Partial of Q9UIR0-1
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Negative regulator of T-cell proliferation.
Gene References into Functions
  1. Host-genotype analysis revealed an association of the rs2076530 (BTNL2) risk allele with a decrease in bacterial burden in sarcoidosis. PMID:29242257
  2. HLA-DPB1*05:01 gene was associated with the geographical region of PV and the BTNL2 gene was significantly associated with family history and age of onset of PV. In conclusion, the HLA-DPB1*05:01 and BTNL2 genes might be responsible for the complicacy of clinical features. PMID:28581127
  3. The sarcoidosis risk variant BTNL2 c.1078G.A (rs2076530) was associated with disease in all OFG cases (P (1/4) 0.013; OR (1/4) 1.33; 95% CI, 1.06-1.67) and had a similar OR (1.56) and the same direction of effect as seen in sarcoidosis. However, no association was seen for the subphenotypes of OFG only or OFG+CD. PMID:27306066
  4. Despite a significant difference in BTNL2 polymorphism between sarcoid patients and controls, there was no such difference between familial and sporadic sarcoidosis cases and no correlation between BTNL2 polymorphism and disease severity or outcome. Thus, BTNL2 difference cannot be considered as a key marker for disease classification or patient management. PMID:27914482
  5. Two new signals were observed at genome-wide significance (P < 5 x 10-8), namely, rs7216064 (17q24.3, BPTF), for overall lung adenocarcinoma risk, and rs3817963 (6p21.3, BTNL2) which is specific to cases with EGFR mutations. In further sub-analyses by EGFR status, rs9387478 (ROS1/DCBLD1) and rs2179920 (HLA-DPB1) showed stronger estimated associations in EGFR-positive compared to EGFR-negative cases PMID:28025329
  6. BTNL2 variant is associated with psoriasis. PMID:27213287
  7. Butyrophilin-like 2, expressed at various levels by UM cells and macrophages, might interfere with the immune control of the tumor. Butyrophilin-like 2 variants showed highly variable frequencies among ethnically related cohorts. There was no enrichment of BTNL2 variants in patients with UM compared with control patients. PMID:27532663
  8. BTNL2 G16071A gene polymorphism may as a likelihood factor contributed to granulomatous disease susceptibility, especially increasing the sarcoidosis susceptibility. In addition, the polymorphism may be greatly associated with likelihood of granulomatous diseases among Caucasians. PMID:27472712
  9. BTNL2 may have an inhibitory effect on FOXP3(+) T cell proliferation, especially in patients homozygous for the risk alleles. PMID:26679868
  10. genetic mutations within or around BTNL2 (rs3763313, rs9268494, rs9268492 and rs9268402) could alter susceptibility to grade IV of dilated cardiomyopathy in a Chinese population PMID:26617759
  11. Results confirm the association of BTNL2 rs2076530SNP with the susceptibility to develop sarcoidosis, but not with an increased risk of cancer in these patients. PMID:25078641
  12. BTNL2 rs2076530 polymorphism contributes to the risk of sarcoidosis PMID:25849037
  13. Two independent loci near BTNL2 (rs9461741) and HLA-B (rs2922994) in the HLA region significantly associated with Marginal Zone B-Cell Lymphoma risk. PMID:25569183
  14. The association of the rare variant p.G454C in BTNL2 reached genome-wide significance, and was independent of the known common risk variants for IBD in the HLA region in both a conditional and haplotype analysis PMID:25671699
  15. These findings suggest that polymorphisms in the BTNL2 gene might play a vital role in determining the outcome of the immune response to hepatitis B vaccination. PMID:24664813
  16. No variation except in the 329-bp region containing the BTNL2 rs2076530 polymorphism was found in Turkish patients with sarcoidosis. PMID:25551927
  17. Rare BTNL2 variants play a role in susceptibility to both familial and sporadic prostate cancer. Results implicate BTNL2 as a novel prostate cancer susceptibility gene. PMID:23833122
  18. the BTNL2 splice site polymorphism (A variant of rs2076530) shows association with an increased risk for persistent sarcoidosis PMID:23904553
  19. sequenced single-nucleotide variants in an association study of 432 cases and 432 controls showed that 12 non-synonymous single-nucleotide polymorphisms (SNPs) in BTNL2 were significantly associated with RA PMID:23364395
  20. Results show that single nucleotide polymorphism associated with BTNL2 gene is a risk factor for predisposition pulmonary sarcoidosis PMID:23017494
  21. Upon stratification analysis in search for a synergistic effect in sarcoidosis given the extensive linkage disequilibrium between BTNL2 rs2076530_A and HLA-DRB1*08:03; the risk-bearing allele of these two loci interact negatively. PMID:22991420
  22. We unravel the role of unexplored immunologically important genes, BAT1 and BTNL2, and the haplotypes of the significantly associated SNPs therein, to understand susceptibility to the disease, leprosy and its differential severity. PMID:22071774
  23. The rs10947262 and rs7775228 variants are not associated with risk of knee osteoarthritis in European descent populations. PMID:21853121
  24. The BTNL2 A allele variant occurs with a high frequency in Danish patients with sarcoidosis PMID:21410903
  25. The presence of a BTNL2G16071A variant allele almost doubles the risk of progressing to persistent pulmonary sarcoidosis in addition to increasing the risk of developing sarcoidosis. PMID:21256912
  26. preliminary data suggest that BTNL2 polymorphism may be associated with susceptibility to Kawasaki disease and coronary artery lesions in Taiwanese children PMID:19882345
  27. This genetic study reveals a significant association between the rs3763313, rs9268494, rs9268492 SNPs in the BTNL2 gene and tuberculosis. PMID:20176143
  28. the absence of a membrane anchored BTNL2 protein may increase genetic susceptibility to sarcoidosis and familial occurrence of the disease. PMID:20560297
  29. Sarcoidosis is associated with a truncating splice site mutation in BTNL2 PMID:15735647
  30. BNTL2 associates with sarcoidosis in both White Americans and African-Americans, with risk effects in Whites independent of HLA-DRB1 associations, and negative interactions between BRNL2 and HLA classII in African-Americans. PMID:16080124
  31. Association of the truncating splice site mutation in BTNL2 with multiple sclerosis is secondary to HLA-DRB1*15. PMID:16321988
  32. resiults show that BTNL2 rs2076530 polymorphism is associated with type 1 diabetes, rheumatoid arthritis, and systemic lupus erythematosus because of its strong linkage disequalibrium with predisposing HLA DQB1-DRB1 haplotypes in Caucasian populations PMID:16690410
  33. RAGE and its ligands with sarcoidosis and suggest that an intrinsic genetic factor could be in part involved in its expression. In Italian patients, the -374 T/A polymorphism seems to be significantly associated with this disease. PMID:17170388
  34. Structural analysis of BTNL2 shows a molecule with an extracellular region containing two sets of two Ig domains, a transmembrane region, and a previously unreported cytoplasmic tail PMID:17237401
  35. Coding regions of BTNL2 were sequenced to detect known and novel polymorphisms and genotyped 18 SNPs in 432 pulmonary tuberculosis cases and 482 controls. PMID:17347014
  36. a major effect of the BTNL2 rs2076530 (G --> A) SNP in Crohn's disease and tuberculosis was excluded; there was an association with susceptibility to leprosy (P=0.04), however, this is most likely due to linkage disequilibrium with HLA-DR PMID:17493147
  37. Does not contribute to susceptibility to Crohn's disease in Japan but is associated with Japanese ulcerative colitis because of strong linkage disequilibrium with HLA-DRB1*1502. PMID:17610417
  38. Some haplotypes are associated with non-Lofgren sarcoidosis. PMID:17661910
  39. Both DRB1*13 and BTNL2 rs3117099TT homozygosity are associated with chronic beryllium disease [CBD] in *Glu69-negative subjects, while DPB1*Glu69 is associated with CBD and Be sensitivity compared with Be exposed PMID:17927685
  40. BTNL2 gene might be one of the candidate genes that is responsible for the pathogenesis of Dermatophagoides farinae (Der f)-specific IgE responsiveness. PMID:19050377
  41. Genome-wide significant evidence for association was found in a region spanning BTNL2 to HLA-DQB1 on chromosome 6p21 for ulcerative colitis. PMID:19122664
  42. The CNV_ID 507 was tested for association in a cohort of 89 sarcoidosis patients and 89 matched controls, but our results indicated that CNV_ID 507 does not affect the genomic structure of BTLN2 as previously described PMID:19140834
  43. Single-nucleotide polymorphism in the BTNL2 gene is associated with ulcerative colitis. PMID:19659809

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein. Note=Isoform 2 is present in the nuclear, vesicle and plasma membranes, isoform 3 is found in cytoplasmic vesicle structures and is not membrane bound.
Protein Families
Immunoglobulin superfamily, BTN/MOG family
Tissue Specificity
Expressed in brain, heart, kidney, liver, pancreas, ovary, leukocyte, small intestine, testis and thymus.
Database Links

HGNC: 1142

UNIGENE: Hs.534471

KEGG: hsa:56244

STRING: 9606.ENSP00000419512

OMIM: 606000

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products