Home
Product
Protein
Recombinant Proteins
Recombinant Human Bombesin receptor subtype-3 (BRS3), partial

Recombinant Human Bombesin receptor subtype-3 (BRS3), partial

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

BRS3

Uniprot NO.

P32247

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-41

Target Protein Sequence

MAQRQPHSPNQTLISITNDTESSSSVVSNDNTNKGWSGDNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Role in sperm cell division, maturation, or function. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

These results suggest that human BRS-3, similar to GRPR/NMBR, is frequently ectopically-expressed by lung-cancer cells in which, it is functional, affecting cell signaling/growth. PMID:29410320
mammalian homologue of CCHa2-R, Bombesin receptor subtype-3 (Brs3), is an orphan receptor that is expressed in the islet beta-cells PMID:26020940
High BRS3 expression is associated with liver metastases of pancreas neuroendocrine tumors. PMID:25241033
The role of the human BRS-3 receptor in glucose homeostasis. PMID:24220502
Data show that gastrin-releasing peptide receptor/bombesin receptor subtype-3 positive cells and protein expression in tumors decreased by treatment with RC-3095 or gemcitabine alone or greater in combination. PMID:24326363
BRS-3 plays an important role in glucose metabolism. PMID:23291341
BRS-3 agonist-dependent signaling mediates CREB phosphorylation and transactivation through protein kinase (PK)A, (PK)C, and mitogen-activated protein/extracellular regulated kinase kinase (MEK)-1 pathways. PMID:22127929
These results identify a potential role for BRS-3 in islet physiology, with agonism directly promoting glucose-stimulated insulin secretion PMID:21878513
results indicate that the sequence variation in the E3 loop is responsible for the species difference between rat and human BRS-3, and multiple residues in the E3 loop are involved in interactions with the agonist dY-bombesin PMID:12102638
Study found that the BRS-3 agonist stimulated adhesion of NCI-N417 cells in laminin-coated culture wells suggesting that BRS-3 may be involved in invasion and metastasis of certain cancer cells PMID:16979789
Data suggest that activator protein 2alpha and peroxisome-proliferator-activated receptor alpha may be especially involved in the ozone-inducible up-regulation mechanism of bombesin receptor subtype 3 expression. PMID:17355223
The secretion of TGF-beta1 increased and the synthesis of PGE2 decreased from BRS-3-activated BEC, which were correlated with the proliferation and collagen synthesis of HLF. PMID:17714959