SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G. Modulates the inflammatory and immune responses after bacterial infection, and after infection by the intracellular parasite L.major. Down-regulates responses to bacterial lipopolysaccharide (LPS). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses. Has antimicrobial activity against mycobacteria, but not against salmonella. Contributes to normal resistance against infection by M.tuberculosis. Required for normal resistance to infection by L.major. Required for normal wound healing, probably by preventing tissue damage by limiting protease activity. Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells.
Gene References into Functions
Study indicate that SLPI seems to be one of the important immunomodulatory proteins that provide local immune response in cervical mucosa.PMID:30180755
we investigated the biological effects of SLPI using Cell Counting Kit (CCK)-8, Annexin V/PI apoptosis assay and Caspase-Glo(R) 3/7 assay. The findings revealed that SLPI promoted apoptosis in the Leuk1 and WSU-HN4 cell lines. Mechanistic studies indicated that SLPI, at least in part, regulated cell apoptosis by inhibiting the expression of TNF receptor-associated factor 1PMID:29436667
Together, these data support the clinical evaluation of dual angiogenic inhibition of the ALK1 and VEGF pathways in patients with advanced renal cell carcinoma (RCC) .PMID:28031424
the patients with systemic sclerosis had significantly increased serum levels of SLPI in comparison with the rheumatoid arthritis patients and the healthy controlsPMID:28606626
gene expression profiling study based on microarray data for the three cell types identified a number of candidates, including LCP1 and GLI, that could be key molecules in the mechanism of SLPI-induced cell migrationPMID:28637988
we show that SLPI acts as a key mediator in regulating the function of hepatic myeloid cells, to promote resolution responses through induction of MerTK expression within the resident macrophage population.PMID:28450389
these data demonstrate increased anti-inflammatory activity of the SLPI-A16G protein compared with SLPI-WT in a murine model of pulmonary Pseudomonas infectionPMID:26376365
we demonstrated that the oncogenic effect of SLPI may be due to protection of growth factor progranulin from enzymatic cleavage or suppression of castration-resistant prostate cancer (CRPC)cell apoptosis independent of anti-protease activity of SLPI. These findings implicate SLPI as a potential biomarker of resistance to AR inhibition and therapeutic target for CRPC treatmentPMID:26876202
Secretory leukocyte protease inhibitor mediates invasiveness of oral carcinoma cells.PMID:27238568
The results indicate that SERPINE2 and SLPI play a significant role in the development of papillary thyroid cancer and imply that the evaluation of serum concentrations of both anticoagulant molecules may be considered as additional marker for the differentiation of malignancies during the preoperative diagnosis of patients with thyroid gland tumors.PMID:28255192
Bronchial epithelial cells have decreased SLPI expression in response to hypoxia.PMID:25851169
Ongoing herpes simplex virus infection and resultant downregulation of local levels of SLPI may impart a greater susceptibility for keratinocytes to human papillomavirus type 16 infection through the host cell receptor annexin A2.PMID:26555393
SLPI is an independent predictor for both OS and DSS and a relevant prognostic biomarker in OSCC.PMID:24764155
The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor.PMID:25559229
These results demonstrate that SLPI down-regulates pIgR expression through the NF-kappaB signaling pathway by inhibiting degradation of IkappaBbeta protein.PMID:26239418
Abnormal over-expression of SLPI in pancreatic cancer cells may be associated with the development of disease through its roles in promoting cancer cell survival and proliferation as well as anti-apoptosis.PMID:25319722
study identifies a distinct immune response in SA characterized by a dysregulated IFN-gamma/SLPI axis that affects lung function.PMID:26121748
findings support a controlling role for SLPI in NET generation, which is of potential relevance to infectious and autoinflammatory diseasesPMID:25917460
We identify SLPI as a new player in acquisition of microbial hyporesponsiveness by buccal and intestinal epithelium in the first weeks after microbial colonisation.PMID:25056659
Studies suggest that secretory leukocyte protease inhibitor (SLPI) as a mediator of systemic immune paresis in acute liver failure (ALF).PMID:25041028
Report presence of SLPI in vaginal secretions and its regulation in response to vaginal microbiota and to the concentrations of antimicrobial and proinflammatory mediators.PMID:24023032
Both mRNA and protein levels of SLPI were significantly higher in patients with biofilm associated chronic rhinosinusitis (CRS) than those with CRS and no biofilm and controls.PMID:24121782
These results show that Mycobacterium tuberculosis-induced IFN-gamma down-modulated SLPI levels by signaling through the IFN-gammaR in healthy donors.PMID:24606882
SLPI has antiprotease activity and antimicrobial activity against bacteria and fungi. SLPI is an important molecule in the functioning of the innate immune system.PMID:16336202
findings demonstrate that SLPI plays an important role from the initial stages of lung carcinogenesis to the progression of lung cancer in an NF-kappaB-dependent mannerPMID:24282288
These results indicate that SLPI controls the proliferation, differentiation, and cell cycle of myeloid cells.PMID:24352879
The aim of this study was to investigate the intracellular function of SLPI and the mechanism-based modulation of neutrophil function by this antiprotease.PMID:24073410
Low SLPI expression is associated with papillomavirus infected head and neck squamous cell carcinomas.PMID:23996702
SLPI is bactericidal for gonococci and is expressed by reproductive tract epithelial cells and thus is likely to play a role in the pathogenesis of gonococcal infection.PMID:22537232
SLPI may contribute to psoriasis by enabling pDCs to sense extracellular DNA and produce IFN type I.PMID:22786767
Circulating SLPI increases with progressive metabolic dysfunction and is related to metabolic and inflammatory parameters in menPMID:21377455
confirmed that SLPI is significantly down-regulated in NPC tissues. In addition, based on our preliminary results, we propose that the reduction of SLPI in NPC cells is associated with the presence of the EBV genome and/or expression of EBV-encoded genesPMID:22493362
decreased expression in female reproductive tract in postmenopausal women with hormonal treatmentPMID:21940052
Results show that SLPI promotes the metastasis of SNU638 gastric cancer cells by increasing MMP-2 and MMP-9 expression through Elk-1 signaling, indicating its role as a signaling molecule not a protease inhibitor.PMID:21687932
SLPI may possess antitumorigenic activity by virtue of its ability to interfere with multiple requisite proteolytic steps underlying tumor cell invasion.PMID:21641406
SLPI stimulates ovarian cancer invasion, modulated in part by its serine protease inhibitory activity attenuating MMP-9 release.PMID:21676452
The results presented here clearly indicate the repression of SLPI, measurable on both, mRNA and protein levels in metastatic primary HNSCC as compared to non-metastatic HNSCC.PMID:21503571
Constitutive expression of SLPI directly reduces the inflammatory response in the respiratory tract and improves lung function in an acute model of allergic asthma in SLPI transgenic and knockout mice.PMID:21335488
these findings indicate upregulation of SLPI in response to LPS in nasal secretions and show anti-apoptotic effects of SLPI in primary human neutrophils suggesting a new role of SLPI during neutrophilic inflammation.PMID:21077989
SLPI inhibited the expression of MMP-9 and IL-8 in normal human bronchial epithelial cells induced by cigarette smoke extract.PMID:18953959
17Beta-estradiol inhibits IL-8 in cystic fibrosis by up-regulating secretory leucoprotease inhibitorPMID:20378727
Our observations are the first to implicate SPARC, SLPI, and NLRP2, a component of the innate immune system, in the pathogenesis of axial spondyloarthropathyPMID:19900269
Secretory leukocyte protease inhibitor antagonizes paclitaxel in ovarian cancer cells, and contribute to drug resistance.PMID:20068074
Using transgenic mice over-expressing secretory leukocyte protease inhibitor, this study shows an early protective effect after spinal cord contusion injury.PMID:20047904
Synthesized locally at mucosal sites. Efficiently inhibit target enzymes released into interstitium. Might be important in controlling excessive neutrophil elastase release in chronic obstructive pulmonary disease and cystic fibrosis. (review)PMID:11667971
Secretory leukocyte protease inhibitor in punch biopsies from human colonic mucosa.PMID:11759111
possible role in the defence against ascending urinary tract infections; establishing a source of SLPI in renal tubuli cells.PMID:11817677
Secretory leukocyte proteinase inhibitor and elafin are resistant to degradation by MMP-8.PMID:11868825
results indicate that menstrual status (pre- vs. postmenopausal) influences the production of SLPI and bactericidal activity by uterine epithelial cellsPMID:12023766
mediates proliferation of human endometrial epithelial cells by positive and negative regulation of growth-associated genesPMID:12023969
Show
More
Hide
All
Subcellular Location
Secreted.
Tissue Specificity
Detected in blood plasma. Detected in bone marrow myeloid cells. Detected in airway sputum. Detected in parotid gland secretions. Detected in seminal plasma (at protein level). Detected in uterus cervix.