Recombinant Human Adhesion G-protein coupled receptor G6 (ADGRG6), partial

Code: CSB-EP768200HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ADGRG6
Uniprot NO.
Research Area
Others
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
38-437aa
Target Protein Sequence
CANCRVVLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQNILRHPEVKVQSKVAEWL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
G-protein coupled receptor which is activated by type IV collagen, a major constituent of the basement membrane. Couples to G(i)-proteins as well as G(s)-proteins. Essential for normal differentiation of promyelinating Schwann cells and for normal myelination of axons. Regulates neural, cardiac and ear development via G-protein- and/or N-terminus-dependent signaling. May act as a receptor for PRNP which may promote myelin homeostasis.
Gene References into Functions
  1. The association of a single nucleotide polymorphism in GPR126 with aggressive periodontitis in a Japanese population. The role of GPR126 in maintaining the homeostasis of periodontal ligament tissues. PMID:27509131
  2. Together, these data uncover Gpr126 as a genetic cause for the pathogenesis of Adolescent idiopathic scoliosis (AIS) and pectus excavatum in a mouse model. PMID:25954032
  3. Genetic variants of GPR126 gene are associated with adolescent idiopathic scoliosis susceptibility in Chinese populations. PMID:25479386
  4. Mutations of GPR126 are responsible for severe arthrogryposis multiplex congenita. PMID:26004201
  5. GPR126 modulates both physiological and pathological angiogenesis through VEGF signaling PMID:25217645
  6. Gpr126 functions in Schwann cells for proper development and myelination through G-protein-signaling pathways. PMID:24227709
  7. A single nucleotide polymorphism in the GPR126 gene is associated with increased susceptibility for adolescent idiopathic scoliosis. [Meta-analysis] PMID:23666238
  8. Possible new targets for GPCR modulation: allosteric interactions, plasma membrane domains, intercellular transfer and epigenetic mechanisms. PMID:21929287
  9. The PS1TP2 gene was located at 6q24.1, and interacts with leukocyte proteins. PMID:18304421
  10. VIGR represents a novel G protein coupled receptors of the adhesion family, which is unique in its long extra-cellular domain. PMID:15225624
  11. APG1 formed an alpha-helical structure at the C-terminal site and a positive charge cluster at the N-terminal site. PMID:17109822

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily
Tissue Specificity
Expressed in placenta and to a lower extent in pancreas and liver. Detected in aortic endothelial cells but not in skin microvascular endothelial cells.
Database Links

HGNC: 13841

UNIGENE: Hs.743302

KEGG: hsa:57211

STRING: 9606.ENSP00000356581

OMIM: 606255

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products