Recombinant Human/Cynomolgus monkey Activin receptor type-2A (ACVR2A), partial (Active)

In Stock
Code: CSB-YP001260HU1
Size:
20ug
20ug100ug1mg
US$250
Quantity:
Express system: Yeast
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human/Cynomolgus monkey ACVR2A protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 5.139-5.959 ng/mL.
Target Names
ACVR2A
Uniprot NO.
Alternative Names
Activin receptor type-2A; EC:2.7.11.30; Activin receptor type IIA (ACTR-IIA; ACTRIIA);ACVR2A; ACVR2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
20-135aa
Target Protein Sequence
AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.5 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human ACVR2A at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 5.139-5.959 ng/mL.
Description

Activin receptor type-2A mediates TGF-β superfamily signaling that regulates muscle growth, bone homeostasis, and metabolic pathways, making it a target of interest in cachexia and muscular dystrophy research. This yeast-expressed extracellular domain fragment (aa 20–135) demonstrates quantifiable antibody-binding activity with an EC50 of 5.139–5.959 ng/mL in functional ELISA, providing a validated reagent for competitive inhibition assays and blocking antibody screening campaigns aimed at modulating activin signaling. The low endotoxin burden (less than 1.0 EU/μg) supports use in cell-based receptor-ligand interaction studies where inflammatory artifacts must be minimized, while the greater than 90% purity meets the quality thresholds commonly required for ligand-binding assays conducted by SPR or BLI. Researchers developing therapeutic antibodies targeting the ACVR2A ectodomain can apply this protein in epitope mapping experiments and as a positive control in binding assays that characterize candidate biologics.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for activin A, activin B and inhibin A. Mediates induction of adipogenesis by GDF6.
Gene References into Functions
  1. Altered decidual ACVR2A expression impairs the ability of stromal cells to properly decidualise and regulate trophoblast function at the maternalfetal interface, which may result in abnormal placentation that can lead to poor pregnancy outcomes such as pre-eclampsia. PMID:29203340
  2. Results showed no association between genotypes and preeclampsia for polymorphisms rs5186, rs4606 in 3'UTR of genes ACVR2A, AGTR1 and RGS2 in women with preeclampsia PMID:29593124
  3. TGF-beta receptor mediated telomerase inhibition, telomere shortening and breast cancer cell senescence.( PMID:27696331
  4. This locus harbors an evolutionary conserved gene-desert region with non-coding intergenic sequences likely involved in regulation of protein-coding flanking genes ZEB2 and ACVR2A. This region is intensively studied for mutations causing severe developmental/genetic disorders. Our analyses indicate a promising target region for interventions aimed to reduce risks of many major human diseases and mortality. PMID:27832070
  5. Data suggest ALK1 and ACVR2A/ACVR2B, acting as BMP9 co-receptors, rearrange pro-domains of BMP9--pro-domain dimer complex leading to displacement of pro-domains after receptor binding, release of mature non-dimer BPM9, and activation of signaling. PMID:26677222
  6. Activin A inhibited signaling by BMP-6 and BMP-9 by competing for type 2 receptors ACVR2A and ACVR2B. PMID:26047946
  7. Data suggest that an SNP in promoter region of ACVR2A (rs1424954, the pre-eclampsia susceptibility allele) down-regulates 1) expression of ACVR2A in trophoblasts and 2) signal transduction in response to excess activin-A (as seen in pre-eclampsia). PMID:25659497
  8. Adenomyotic tissues express high levels of myostatin, follistatin, and activin type II receptors. PMID:26086422
  9. The gene ACVR2A was associated with the more severe early onset preeclampsia. PMID:25499008
  10. For ACVR2A SNPs (rs10497025, rs1128919, rs13430086), no statistically significant difference was found between preeclampsia and control groups in terms of genotype and allele frequencies. PMID:23633461
  11. ACVR2A was identified as a subnetwork component in functional association network analysis. PMID:23263486
  12. ACVR2A showed statistically significant differential dose-expression relationship. PMID:22848350
  13. ACVR2A interaction with Nodal and ADMP regulates head development from the 'organizer', a restricted group of cells in the embryo. PMID:22949641
  14. This is the first report on the function of miR-195 in human placental trophoblast cells which reveals an invasion-promoting effect of the small RNA via repressing ActRIIA. PMID:22723898
  15. Activin type IIA receptors are clearly demonstrable throughout the adult human hypothalamus and basal forebrain. PMID:22296042
  16. Exonic selectivity for frameshift mutation within ACVR2 is specifically controlled by individual nucleotides flanking each coding ACVR2 microsatellite. PMID:22001236
  17. Mutation in activin type II receptor is associated with colorectal cancer. PMID:20197483
  18. crystal structure of BMP7 in complex with the extracellular domain (ECD) of the activin type II receptor PMID:12667445
  19. Activin type II receptor gene (ACTRII) is probably involved in both non-microsattelite unstable and microsattelite-unstable colorectal carcinogenesis, but more frequently in the latter subgroup. PMID:14691305
  20. Data indicate that activin A and activin receptors IIA and IIB may be involved in the regulation of germ cell proliferation in the human ovary during the period leading up to primordial follicle formation. PMID:14738881
  21. Mutations highly frequent in microsatellite unstable(MSI-H) colon cancers and cause loss of ACVR2, indicating biallelic gene nactivation. Loss of activin signaling through mutation of ACVR2 may have role in genesis of MSI-H colorectal cancer. PMID:14988818
  22. demonstrates that truncating mutations of the ACVR2 gene result in a significant reduction in activin mediated cell signaling. Inactivation of ACVR2 is a common event in prostate cancer and may play an important role in the development of prostate cancer PMID:16337854
  23. structure of the ternary complex representing the signaling competent complex of BMP-2 bound to the entire extracellular domains of both its type I receptor, BMPR-Ia, & its type II receptor, ActRII, at a resolution of 2.2 angstroms PMID:16672363
  24. Activin is growth suppressive and enhances migration in colon cancer. PMID:17258738
  25. RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and that increased utilization of ActRIIA leads to generation of an enhanced BMP signal PMID:17472960
  26. Inhibin/activin BA subunit, follistatin, and activin receptor proteins and mRNAs are present in the human fetal palate. PMID:18001154
  27. Populations with different ancestors (Iceland/Norway-Australia/New Zealand) demonstrate a common maternal pre-eclampsia susceptibility locus on chromosome 2q22-23, may suggests a general role of this locus, and possibly the ACVR2A gene, in pre-eclampsia. PMID:18781190
  28. The -1 bp frameshift mutation rates of TGFBR2 and ACVR2 microsatellite sequences are dependent upon the human DNA Mismatch PMID:18941508
  29. It remains unclear what role, if any, ACVR2A polymorphisms play in pre-eclampsia risk, at least in these Australian families. PMID:19126782
  30. ActRII signaling is required for prostatic cancer cell and neuroblastoma cell viability, with ActRII mediating cell fate via the regulation of cell adhesion PMID:19308291
  31. The four most frequently mutated genes in colorectal cancers with microsatellite instability were ACVR2 (92%), TAF1B (84%), ASTE1/HT001 (80%) and TGFBR2 (77%). PMID:19503063

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Database Links

HGNC: 173

UNIGENE: Hs.470174

KEGG: hsa:92

STRING: 9606.ENSP00000241416

OMIM: 102581

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products