Recombinant Human RNA-binding protein RO60 (RO60), partial

In Stock
Code: CSB-EP025071HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TROVE2
Uniprot NO.
Alternative Names
60 kDa ribonucleoprotein Ro; 60 kDa Ro protein; 60 kDa SS A/Ro ribonucleoprotein; 60 kDa SS-A/Ro ribonucleoprotein; Autoantigen Ro/SSA, 60-KD; bA101E13.2; Gastric cancer multi drug resistance protein; Ribonucleoprotein autoantigen SS A/Ro; RO 60; Ro 60 kDa autoantigen; RO60; RO60_HUMAN; RoRNP; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; Sjogren syndrome antigen A2 (60kD ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2 (60kDa ribonucleoprotein autoantigen SS A/Ro); Sjogren syndrome antigen A2; SS A; SS-A; SS-A/Ro; SSA 2; SSA; SSA2; TROVE 2; TROVE domain family member 2; TROVE2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3-535aa
Target Protein Sequence
ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Recombinant Human RNA-binding protein RO60 is expressed in E. coli with an N-terminal 6xHis-tag, covering the 3-535 amino acid region. This partial protein is produced with purity exceeding 90%, as verified by SDS-PAGE analysis. It is intended for research use only and is not suitable for therapeutic or diagnostic applications.

The RO60 protein appears to be a key component in cellular machinery, particularly known for its role in RNA binding and processing. It seems to be involved in stabilizing cellular RNA molecules and has become a subject of interest in studies focusing on RNA metabolism and autoimmune responses. Researchers rely on RO60 to explore its functions and interactions within various cellular pathways, though the complete picture of its role may be more complex than initially understood.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human RO60 protein is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing properly folded eukaryotic RNA-binding proteins. RO60 requires precise folding for its RNA-binding activity and interaction with other cellular components. The recombinant RO60 protein is expressed as a near-full-length fragment (3-535aa, missing only the first 2 amino acids) with an N-terminal 6xHis tag. While the length covers almost the entire protein and purity is >90%, E. coli lacks the eukaryotic chaperones and post-translational modification machinery necessary for the correct folding of complex RNA-binding proteins. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its RNA-binding capability and proper conformation.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis tag enables technical feasibility for pull-down assays. However, if RO60 is misfolded (as is likely in E. coli), it may not interact physiologically with true binding partners. RNA-binding proteins require specific conformations for proper interactions. Identified interactions could be non-physiological artifacts. This application should only be pursued after confirming proper folding through biophysical characterization.

2. Antibody Development and Validation

This application is appropriate as the safest use case. The near-full-length RO60 can serve as an effective immunogen for generating antibodies that recognize linear epitopes. The high purity and substantial coverage (3-535aa) support antibody production. However, if misfolded, antibodies may not recognize conformational epitopes of native RO60. Validation against endogenous RO60 is recommended.

3. Biochemical Characterization and Biophysical Analysis

This application is well-suited and should be prioritized. Techniques like size-exclusion chromatography, dynamic light scattering, and circular dichroism can directly assess the protein's folding state, oligomerization, and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant product itself.

4. His-Tag Based ELISA Development

This application is feasible for detection but has limitations. The His-tag enables technical development of ELISA assays. However, if RO60 is misfolded, quantitative measurements may not correlate with native protein function. The assay may work for detection, but requires validation against properly folded RO60 for accurate quantification.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, recommend first performing a comprehensive biophysical characterization to assess folding quality. This should include circular dichroism spectroscopy for secondary structure analysis and size-exclusion chromatography with multi-angle light scattering for oligomeric state assessment. Antibody development can proceed immediately as the lowest-risk application. Protein interaction studies and quantitative assays should await proper folding validation. For reliable RO60 functional studies, consider obtaining the protein from eukaryotic expression systems capable of proper folding. Always include appropriate controls, such as known RNA substrates, when possible.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
RNA-binding protein that binds to misfolded non-coding RNAs, pre-5S rRNA, and several small cytoplasmic RNA molecules known as Y RNAs. May stabilize some of these RNAs and protect them from degradation. Binds to endogenous Alu retroelements which are induced by type I interferon and stimulate porinflammaotry cytokine secretion. Regulates the expression of Alu retroelements as well as inflammatory genes.; May play roles in cilia formation and/or maintenance.
Gene References into Functions
  1. TROVE2 is a novel target of miR-128 in astrocytoma tissues and the expression of TROVE2 is increased with the pathological stages increasing. PMID:26307612
  2. Significant relationships were found between clinical and laboratory manifestations of autoimmune and rheumatic diseases with different patterns of antibodies to anti-Ro52, anti-Ro60 and anti-La. PMID:26725021
  3. These findings establish a link among the lupus autoantigen Ro60, Alu retroelements, and type I interferon. PMID:26382853
  4. Findings indicate a relentless turnover of short-lived clonotypic variants, masquerading as long-lived Ro60 humoral autoimmunity. PMID:23644453
  5. The Y3 RNA moiety of the Ro60 ribonucleoprotein plays a critical role in the pathogenesis of fetal cardiac injury by altering the subcellular location of Ro60 autoantibodies. PMID:23698747
  6. these data indicate that ZBP1 may function as an adapter to export the Ro/Y3 RNA complex from nuclei. PMID:22114317
  7. conclude that RNPs containing hY RNAs and Ro60, La or nucleolin are not required for the function of hY RNAs in chromosomal DNA replication in a human cell-free system, which can be mediated by Y RNAs outside of these RNPs PMID:21060685
  8. dichotomy of human autoantibody responses against mutually exclusive determinants linked to a single domain of a systemic autoantigen and supports a model in which tolerance is broken by different immunogenic forms of Ro 60 PMID:20131295
  9. Activation of Toll-like receptors by fetal factor Ro60-associated single-stranded RNA particles is relevant in autoimmune-associated congenital heart block, where the obligate maternal factor is an anti-SSA/Ro autoantibody. PMID:20089705
  10. In viitro RNA chaperone activity of SSA2 was studied. PMID:15928345
  11. The structural organization and Zn2+-dependent subdomain interactions involving autoiantigenic epitopes in the RBBC region of SS-A were studied. PMID:15964842
  12. interactions between Ro-Y5 and L5-5S RNPs establish 5S RNA as a target of quality control PMID:18056422
  13. results demonstrate that Ro 60 functions as a novel receptor for beta(2)GPI on the surface of apoptotic cells. The formation of Ro 60-beta(2)GPI complexes may protect against anti-Ro 60 autoantibody-mediated tissue injury. PMID:19248095

Show More

Hide All

Subcellular Location
Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Protein Families
Ro 60 kDa family
Database Links

HGNC: 11313

UNIGENE: Hs.288178

KEGG: hsa:6738

STRING: 9606.ENSP00000356411

OMIM: 600063

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products