Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
alpha polypeptide (p32); CD8; CD8 antigen alpha polypeptide; CD8 antigen alpha polypeptide (p32); CD8a; CD8A antigen; CD8A molecule; CD8A_HUMAN; Leu2; Leu2 T lymphocyte antigen; Ly3; LYT3; MAL; OKT8 T cell antigen; OTTHUMP00000160760; OTTHUMP00000160764; OTTHUMP00000203528; OTTHUMP00000203721; p32; T cell antigen Leu2; T cell co receptor; T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; T8 T cell antigen; T8/Leu-2 T-lymphocyte differentiation antigen
Species
Homo sapiens (Human)
Target Protein Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A) is a partial-length protein produced in the E.coli. It contains 22-182aa (Extracellular Domain) of the human CD8A protein and carries a 6xHis-SUMO-tag at the N-terminus. SDS-PAGE analysis measured its purity, reaching up to 90%. Under reducing conditions, this CD8A protein migrated to a band of about 34-37 kDa on the gel. Post-translational modifications such as glycosylation results in a slightly higher result. This recombinant CD8A protein may be used to immunize rabbits or mice to generate specific antibodies and in the CD8A-related immunology studies.
CD8 glycoprotein is expressed as either a homodimer CD8αα or a heterodimer CD8αβ on the surface of T cells. CD8 T cells play a major role in the adaptive immune defense against intracellular pathogens. CD8α or CD8A contains a stalk region directly adjacent to the Ig-like domain and may therefore play a role in mediating CD8-MHCI interaction.
