Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
26 kDa cell surface protein TAPA 1; 26 kDa cell surface protein TAPA-1; 26 kDa cell surface protein TAPA1; CD 81; CD81; CD81 antigen (target of antiproliferative 1); CD81 antigen; CD81 molecule; CD81_HUMAN; CVID6; S5.7; TAPA 1; TAPA1; Target of the antiproliferative 1; Tetraspanin 28; Tetraspanin-28; Tetraspanin28; Tspan 28; Tspan-28; Tspan28
Species
Homo sapiens (Human)
Expression Region
113-201aa
Target Protein Sequence
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004960HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD81.
-
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004960HU could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) CD81.
Description
Enhance your research in immunology with our Recombinant Human CD81 protein, a partial protein derived from the 113-201aa expression region. This protein, also known as CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, and Tetraspanin-28, originates from human sources and is produced using yeast expression systems.
Featuring an N-terminal 6xHis tag, our Recombinant Human CD81 protein allows for efficient purification and easy detection during your experiments. The lyophilized powder form ensures stability and quality, while the protein's purity of greater than 90% as determined by SDS-PAGE guarantees a reliable and robust product for your research needs.
