All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule
All
  • All
  • ELISA Kit
  • Protein
  • Antibody
  • Molecular Biology Product
  • Small Molecule

Recombinant Gorilla gorilla gorilla Insulin (INS)

Code
MSDS
MSDS Datasheet
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Abbreviation
INS
Purity
>85% (SDS-PAGE)
Target Names
INS
Uniprot NO.
Species
Gorilla gorilla gorilla (Western lowland gorilla)
Source
Yeast
Expression Region
25-54
Target Protein Sequence
FVNQHL CGSHLVEALY LVCGERGFFY TPKT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Cytoplasmic domain
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Related Products

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A
Q:

Regarding your protein CSB-MP011742HU(F), do you offer the full-length protein (proinsulin) as a custom protein, since CSB-MP011742HU(F) is listed as unavailable?

A:
Yes, this protein CSB-MP011742HU(F) is discontinued and unavailable. We have another species to recommend, the sequence (mature full length protein) similarity is 100%,
Reference link:http://www.uniprot.org/uniprot/Q6YK33
Recombinant Gorilla gorilla gorilla Insulin(INS)
CSB-YP011742GGZ >> Yeast
CSB-EP011742GGZ >> E.coli
CSB-BP011742GGZ >> Baculovirus
CSB-MP011742GGZ >> Mammalian cell
Expression Region:25-110aa; Mature full length protein.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
Sequence:

FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGI
VEQCCTSICSLYQLENYCN

Target Background

Function(From Uniprot)
Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Subcellular Location
Secreted.
Protein Families
Insulin family
Database Links
Promotions
Reward For Reviews
Free trial size antibodies
Contact Us

  Email: support@cusabio.com
  Distributors Worldwide

Service

Phage Display Service

Antibody Service

Protein Service

Gene Synthesis Service

Oligo Synthesis Service

Related Articles
BTLA: An Emerging Target in Immunotherapy – New Insights into Cancer and Autoimmune DiseasesDecoding Recombinant Protein Expression: Strategic Solutions & Practical InsightsImmune Activation: Insights into T Cell DifferentiationELISA vs. Multiplex Immunoassays: Why ELISA Remains the Gold Standard among ImmunoassaysVerified vs. Unverified Recombinant Proteins: Making the Right Choice for Your ResearchNew Power in the Fight Against Cancer: Spotlight on Rising Stars of ADC Drugs at the 2024 ASCO Annual MeetingMyosin Regulatory Light Chains (MYL12A and MYL12B): the New Functional Ligands for CD69, Potential Targets for Cardiac Disease or Tumors Research?Microglial Markers: Insights into Microglial Activation and FunctionCD20 (MS4A1) Monoclonal Antibodies Drugs: There is an Explosion of New mAbs Against CD20!ZG16B: A New Tumor Biomarker Offers Important Insights for Drug Development in Pancreatic Cancer!Recombinant Monkeypox Virus Proteins - Accelerate Monkeypox Research2021 Insights on the CAR-T Cell Therapy: the Most Popular Targets for Solid Tumor!How to Properly Reconstitute Lyophilized Proteins?Agrimonia pilosa, Galla rhois, and APRG64, Which has the best antiviral activity against SARS-CoV-2?A Group of Promising Proteins - Cell Cycle MarkersBladder Cancer: Insights into Molecular Biology,Signaling Pathways, and BiomarkersDecoding the Biological Complexity of Endometrial Cancer: Essential Insights for ResearchersExosomes act as decoys to protect against bacterial toxinsBiological Activity of ProteinsTET proteins regulate the factors necessary for normal antibody productionA healthy heart needs two proteins to work togetherProteins associated with cancer growth can promote fatal lung diseaseTrapping pathological proteins that cause many neurodegenerative disordersInhibiting oncogenic proteins can prevent scleroderma fibrosisDiscover new deadly factors against melanoma in miceThe proteins released by fat after exercise can improve glucose What Are Immune Checkpoint Proteins?A "trembling" Parkinson's DiseaseApplications of recombinant proteinsEpigenetics expert from Johns Hopkins took a visit to CUSABIOInsect Cell Expression SystemCUSABIO's Five Expression SystemsHow to express a protein with bioactivity?How to choose a suitable expression vector?How to Choose the Right Recombinant Protein for Your Experimental Model?How to Properly Reconstitute Lyophilized Proteins?Verified vs. Unverified Recombinant Proteins: Making the Right Choice for Your ResearchApproaches to Determinate Protein ConcentrationExploring Protein-Protein Interactions: A Comprehensive Guide to Understanding and Utilizing ItWhat Is Protein Characterization: Definition, Examples, Methods, and TechniquesProtein Tags: A Comprehensive Overview
Related pathways
HIF-1 signaling pathwayMAPK signaling pathwaymTOR signaling pathwayPI3K-Akt signaling pathwayRegulation of actin cytoskeletonAutophagyRas signaling pathwayAMPK signalingcGMP-PKG signaling pathwayFoxO signaling pathwayInsulin signaling pathwayPhospholipase D signaling pathwayRap1 signaling pathway
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of email
Email
support@cusabio.com
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Privacy Policy