Recombinant Drosophila melanogaster Wee1-like protein kinase (wee)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Wee1
Uniprot NO.
Alternative Names
Wee1; wee; CG4488Wee1-like protein kinase; Dwee1; EC 2.7.10.2
Species
Drosophila melanogaster (Fruit fly)
Source
Yeast
Expression Region
1-609
Target Protein Sequence
MAFRQSEHEMSVTSLDSSVELRSRSPSPQVFNPRKLRFADDDFDKDTPEGASPQHPLQQR PKLSSGEEQQLDSKIGKEGGDGDVSMSPPCQKVRALRLFSTPATPKTILQKSTTQCSNHL SAAAAAVNASRRSDDLFRLSERPRSLPLHNRKLPTQDTANVNPFTPDSLMAHNKKRCRTQ FGRENLNLNVNAMQKYLLSDACDDDVTEEAGDSMREIHQQAPKRLALHDTNISRFKREFM QVNVIGVGEFGVVFQCVNRLDGCIYAIKKSKKPVAGSSFEKRALNEVWAHAVLGKHDNVV RYYSAWAEDDHMLIQNEFCDGGSLHARIQDHCLGEAELKIVLMHVIEGLRYIHSNDLVHM DLKPENIFSTMNPNAHKLVEVQPQQTKDDDGMDSVYEELRHSENLVTYKIGDLGHVTSVK EPYVEEGDCRYLPKEILHEDYSNLFKADIFSLGITLFEAAGGGPLPKNGPEWHNLRDGKV PILPSLSRDFNELIAQMMHPYPDKRPTSQSIFSHPILSAVDSKSKLQLGLELTVEKRKNE ILMNKLREAKKQIKLLEQRVNLLAVTNNPDSLDGQRCLRSFTRRMRTPFSSHGKFDSISD RNKNVITNI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a negative regulator of entry into mitosis (G2 to M transition). This kinase specifically phosphorylates and inactivates cyclin B1-complexed CDC2.
Gene References into Functions
  1. Relationships between DNA replication, chromosome condensation, and anaphase entry are mediated by the cell cycle kinases Grp (Chk1) and dWee1 (Wee1). PMID:22262459
  2. Phosphorylation of the KLP61F catalytic domain by dWee1 is important for the motor's function. PMID:19800237
  3. Wee1 kinases can regulate mitotic entry in vivo during metazoan development even in cycles that lack a G2 phase. PMID:15589158
  4. Drosophila Wee1 interacts with members of the gammaTURC and is required for proper mitotic-spindle morphogenesis and positioning. PMID:16139207

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family, WEE1 subfamily
Tissue Specificity
Expressed in embryos; expression remains high in the proliferating cells of the central nervous system well after cells in the rest of the embryo have ceased dividing.
Database Links

UNIGENE: Dm.3106

KEGG: dme:Dmel_CG4488

STRING: 7227.FBpp0304607

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1