Recombinant Danio rerio Pro-neuropeptide Y (npy)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

npy

Purity

>85% (SDS-PAGE)

Target Names

npy

Uniprot NO.

Q9I8P3

Alternative Names

npy; Pro-neuropeptide Y [Cleaved into: Neuropeptide Y; Neuropeptide tyrosine; NPY); C-flanking peptide of NPY; CPON)]

Species

Danio rerio (Zebrafish) (Brachydanio rerio)

Source

Yeast

Expression Region

29-96

Target Protein Sequence

YPTKPDNPGEDAPAEELAKYYSALRHYINLITRQRYGKRSSADTLISDLLIGETESRPQTRYEDHLAW
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Gene References into Functions

Overexpression of NPY increases sleep, whereas mutation of npy or ablation of npy-expressing neurons decreases sleep. NPY regulates sleep primarily by modulating the length of wake bouts. PMID:29225025
NPY acts as an orexigenic factor in the zebrafish. PMID:22250860
Neuropeptide Y/peptide YY receptor Y2 duplicate in zebrafish with unique introns displays distinct peptide binding properties.( PMID:21855645
Developmental expression of zYb and zYc receptors suggests a role for neuropeptide Y (NPY) in organogenesis. PMID:15891072
This study suggest that NYP cells of nucleus entopeduncularis and nucleus preopticus periventricularis, and related fiber systems, might be involved in processing of sex steroid-borne information. PMID:17701999
In this study described the the lateral line presence of NPY-like immunoreactivity (IR) in of the Antarctic nototheniod fish. Differences in size and cellular composition between the two neuromasts were presen NPY immunoreactivity. PMID:19442873