Recombinant Coturnix coturnix japonica Tyrosinase (TYR)

Product Details

Abbreviation
TYR
Purity
>85% (SDS-PAGE)
Target Names
TYR
Uniprot NO.
Species
Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
Source
Yeast
Expression Region
19-273
Target Protein Sequence
QFPRVCANTQSLLRKECCPPWEGDGSPCGERSNRGTCQRILLSQAPLGPQFPFSGVDDRE DWPSVFYNRTCRCRGNFMGFNCGECKFGFSGQNCTERRLRTRRNIFQLTIREKDKFLAYL NLAKNIPSKDYVIATGTYAQMNNGSNPMFRNINVYDLFVWMHYYASRDTLLGGSNVWRDI DFAHEAPGFLPWHRAFLLLWEREIQKITGDENFTIPYWDWRDAEDCVICTDEYMGGQHPT NPNLLSPASFFSSWQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the initial and rate limiting step in the cascade of reactions leading to melanin production from tyrosine. In addition to hydroxylating tyrosine to DOPA (3,4-dihydroxyphenylalanine), also catalyzes the oxidation of DOPA to DOPA-quinone, and possibly the oxidation of DHI (5,6-dihydroxyindole) to indole-5,6 quinone.
Subcellular Location
Melanosome membrane; Single-pass type I membrane protein. Melanosome.
Protein Families
Tyrosinase family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1