Recombinant Chlorocebus sabaeus Claudin (CLDN6)-VLPs (Active)

In Stock
Code: CSB-MP6148GKN
Size:
20ug
20ug100ug1mg
US$620
Quantity:
Express system: Mammalian cell
Species: Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)
Tag Info: C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Chlorocebus sabaeus CLDN6 protein-VLPs (Active)
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control.
Target Names
CLDN6
Uniprot NO.
Alternative Names
/
Species
Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)
Source
Mammalian cell
Expression Region
22-220aa
Target Protein Sequence
LVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSRGPSHYMARYSTSAPAISRGPSEYPTKNYV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • CSB-MP025131HU is detected by Mouse anti-6*His monoclonal antibody.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis CLDN6 at 5 μg/ml can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU). The EC50 is 4.186-6.635 ng/mL.The VLPs (CSB-MP3838) is negative control.
Description

Claudin-6 is a tight junction protein aberrantly expressed in several solid tumors, making it a promising target for cancer immunotherapy and antibody-based diagnostics. This full-length mature protein (aa 22–220) presented on virus-like particles demonstrates specific antibody binding in functional ELISA, with an EC50 of 4.186–6.635 ng/mL when tested against an anti-CLDN6/9 recombinant antibody, confirming that the native epitope architecture is preserved. The VLP format provides multivalent antigen display that closely mimics cell surface presentation, supporting use in antibody development and validation workflows where physiologically relevant binding kinetics are essential. With endotoxin levels below 1.0 EU/μg, this reagent aligns with standards expected in cell-based assays for tumor metastasis research and immune cell trafficking studies where low endotoxin is critical for maintaining cellular responsiveness.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products