Recombinant Chlorobium tepidum Maf-like protein CT0974 (maf)

Product Details

Abbreviation
maf
Purity
>85% (SDS-PAGE)
Target Names
maf
Uniprot NO.
Alternative Names
maf; CT0974; dTTP/UTP pyrophosphatase; dTTPase/UTPase; EC 3.6.1.9; Nucleoside triphosphate pyrophosphatase; Nucleotide pyrophosphatase; Nucleotide PPase
Species
Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Source
Yeast
Expression Region
1-197
Target Protein Sequence
MTSHRKLILASQSPRRRELLAMTGIPFETASVEIDETFDPVLTAEENVMEISKQKAEAVL RSISADEACAVVLGSDTTVVLDGKPLGKPGDFDHAFDMLSTLQGRSHEVLTGFCILHNGK AITDYARTIVEIGPMTPREITRYIEVMKPFDKAGSYGIQDPLLACFVTGIDGCYYNVVGL PVSKVYAALKPLFPAEG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.
Subcellular Location
Cytoplasm.
Protein Families
Maf family
Database Links

KEGG: cte:CT0974

STRING: 194439.CT0974

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1