Recombinant Chikungunya virus Non-structural polyprotein,Partial

In Stock
Code: CSB-EP810351CJAT
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Chikungunya virus (strain S27-African prototype) (CHIKV)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot NO.
Research Area
others
Alternative Names
Polyprotein P1234; P1234; Non-structural polyprotein) [Cleaved into: Polyprotein P123; P123); mRNA-capping enzyme nsP1; EC 2.1.1.-; EC 2.7.7.-; Non-structural protein 1); Protease nsP2; EC 3.1.3.33; EC 3.4.22.-; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 2; nsP2); Non-structural protein 3; nsP3; EC 3.1.3.84); RNA-directed RNA polymerase nsP4; EC 2.7.7.19; EC 2.7.7.48; Non-structural protein 4; nsP4)]
Species
Chikungunya virus (strain S27-African prototype) (CHIKV)
Source
E.coli
Expression Region
2228-2474aa
Target Protein Sequence
DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Amino acids 2228-2474 form the expressed segment for recombinant Chikungunya virus nsp4. This nsp4 protein is theoretically predicted to have a molecular weight of 31.1 kDa. This nsp4 protein is produced using e.coli expression system. Fusion of the N-terminal 6xHis tag into the nsp4 encoding gene fragment was conducted, allowing for easier detection and purification of the nsp4 protein in subsequent stages.

The Chikungunya virus non-structural polyprotein plays a central role in viral replication and host interaction. Its primary function involves processing into individual non-structural proteins that contribute to viral RNA synthesis. In virology, understanding this polyprotein is crucial for elucidating the Chikungunya virus life cycle and developing antiviral strategies. In immunology, studying the polyprotein aids in unraveling host-virus interactions, informing vaccine design. The polyprotein's role in pathogenesis makes it a target in infectious disease research. Investigating the Chikungunya non-structural polyprotein provides insights into viral replication mechanisms, host immune responses, and antiviral approaches, offering potential applications in virology, immunology, and vaccine development.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Inactive precursor of the viral replicase, which is activated by cleavages carried out by the viral protease nsP2.; The early replication complex formed by the polyprotein P123 and nsP4 synthesizes minus-strand RNAs. As soon P123 is cleaved into mature proteins, the plus-strand RNAs synthesis begins.; Cytoplasmic capping enzyme that catalyzes two virus-specific reactions: methyltransferase and guanylyltransferase. mRNA-capping is necessary since all viral RNAs are synthesized in the cytoplasm, and host capping enzymes are restricted to the nucleus (Probable). The enzymatic reaction involves a covalent link between 7-methyl-GMP and nsP1, whereas eukaryotic capping enzymes form a covalent complex only with GMP. nsP1 capping consists in the following reactions: GTP is first methylated into 7-methyl-GMP and then is covalently linked to nsP1 to form the m7GMp-nsP1 complex from which 7-methyl-GMP complex is transferred to the mRNA to create the cap structure. NsP1 is also needed for the initiation of the minus-strand RNAs synthesis. At the initiation of virus replication, mediates the assembly of the viral replication complex made of the non-structural proteins, the association of this complex with the inner face of the plasma membrane and the formation of membranous spherules that serve as replication complex factories. Forms the neck of these spherules with a central channel for mediating communication and the passage of RNA, nucleotides, and small proteins between the viral replication complex and the host cytoplasm. Palmitoylated nsP1 is remodeling host cell cytoskeleton, and induces filopodium-like structure formation at the surface of the host cell.; Multifunctional protein whose N-terminus is part of the RNA polymerase complex and displays NTPase, RNA triphosphatase and helicase activities. NTPase and RNA triphosphatase are involved in viral RNA capping and helicase keeps a check on the dsRNA replication intermediates. The C-terminus harbors a protease that specifically cleaves the polyproteins and releases the mature proteins. Required for the shutoff of minus-strand RNAs synthesis. Specifically inhibits the host IFN response by promoting the nuclear export of host STAT1. Also inhibits host transcription by inducing the rapid proteasome-dependent degradation of POLR2A, a catalytic subunit of the RNAPII complex. The resulting inhibition of cellular protein synthesis serves to ensure maximal viral gene expression and to evade host immune response (Probable).; Seems to be essential for minus-strand RNAs and subgenomic 26S mRNAs synthesis. Displays mono-ADP-ribosylhydrolase activity. ADP-ribosylation is a post-translational modification that controls various processes of the host cell and the virus probably needs to revert it for optimal viral replication. Binds proteins of G3BP family and sequesters them into the viral RNA replication complexes thereby inhibiting the formation of host stress granules on viral mRNAs. The nsp3-G3BP complexes bind viral RNAs and probably orchestrate the assembly of viral replication complexes, thanks to the ability of G3BP family members to self-assemble and bind DNA (Probable).; RNA dependent RNA polymerase. Replicates genomic and antigenomic RNA by recognizing replications specific signals. The early replication complex formed by the polyprotein P123 and nsP4 synthesizes minus-strand RNAs. The late replication complex composed of fully processed nsP1-nsP4 is responsible for the production of genomic and subgenomic plus-strand RNAs.
Gene References into Functions
  1. Chikungunya virus (CHIKV) nonstructural protein nsP3 (Nsp3)C-terminal hypervariable domain (HVD) can bind cytoskeletal proteins, including CD2AP, SH3KBP1, CAPZA1, CAPZA2 and CAPZB. Binding site is mapped to the second SH3 ligand-like element in Nsp3 HVD. Mutation of the short binding element hampered the ability of the virus to establish infection. PMID:29702546
  2. In summary, nsP3 can form uniquely stable granular structures that persist long-term within the host cell. PMID:29875241
  3. Therefore, the opal termination codon at the end of the nsp3 gene plays an important role in Chikungunya virus pathogenesis, independently of effects on viral replication. PMID:29138302
  4. Two non-structural proteins, namely, nsP2 and nsP3 were found to exhibit RNAi suppressor activity. PMID:27901124
  5. Cys478 residue in the active site of CHIKV nsP2 is indispensable for P1234 processing. PMID:27845418
  6. Date show that viral nonstructural protein nsP3 (nsP3) mono(ADP-ribosyl)hydrolase activity is critical for Chikungunya virus (CHIKV) replication in both vertebrate hosts and insect vectors, and for virulence in mice. PMID:28143925
  7. data show that the previously described consensus sequence PXRPXR for amphiphysin SH3 ligands is inaccurate and instead define it as an extended Class II binding motif PXXPXRpXR, where additional positive charges between the two constant arginine residues can give rise to extraordinary high SH3 binding affinity. PMID:27268056
  8. Site-directed mutagenesis showed that the mosquito Rin-Chikungunya virus nsP3 interaction involved the NTF2-like domain of Rin and two conserved TFGD repeats in the C-terminal variable domain of nsP3. PMID:26384002
  9. This study shows the essential role and novel function of nsP2 in maintaining alphavirus replication complex fidelity. PMID:26311883
  10. Molecular docking analysis/molecular dynamics simulations leading to enzyme inhibitors targeting nsP3 macro domain of chikungunya virus. PMID:24756552
  11. P718G or E116K mustation of nsp2 markedly reduced RNA synthesis. PMID:25552719
  12. Authors have identified novel interactions between Chikungunya virus nsP3 or nsP4 proteins with the host stress-pathway chaperone HSP-90 protein. PMID:24388965
  13. Functional cross-talk between distant domains of chikungunya virus non-structural protein 2 is decisive for its RNA-modulating activity. PMID:24407286
  14. Results show that nsP2 mutation P718S only in combination with KR649AA or adaptive mutation D711G allowed noncytopathic replicon RNA replication. PMID:23864632
  15. Authors conclude that BST-2 tethers chikungunya virus like particles on the host cell plasma membrane and identify viral nsP1 protein as a novel BST-2 antagonist. PMID:23411007
  16. Chikungunya virus nsP3 blocks stress granule assembly by recruitment of G3BP into cytoplasmic foci PMID:22837213
  17. Viral nsP2 interacts with hostibonucleoprotein K and ubiquilin 4 protein. PMID:22258240
  18. Expression of individual CHIKV nonstructural proteins (nsPs) showed that nsP2 was a potent inhibitor of IFN-induced JAK-STAT signaling. PMID:20686047

Show More

Hide All

Subcellular Location
[Polyprotein P1234]: Host cytoplasmic vesicle membrane; Peripheral membrane protein.; [Polyprotein P123]: Host cytoplasmic vesicle membrane; Peripheral membrane protein.; [mRNA-capping enzyme nsP1]: Host cytoplasmic vesicle membrane; Lipid-anchor. Host cell membrane; Lipid-anchor; Cytoplasmic side. Host cell projection, host filopodium.; [Protease nsP2]: Host cytoplasmic vesicle membrane; Peripheral membrane protein. Host nucleus. Host cytoplasm.; [Non-structural protein 3]: Host cytoplasmic vesicle membrane; Peripheral membrane protein.; [RNA-directed RNA polymerase nsP4]: Host cytoplasmic vesicle membrane; Peripheral membrane protein.
Database Links

KEGG: vg:956309

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products