Recombinant Chicken Vascular endothelial growth factor A (VEGFA)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
VEGFA
Uniprot NO.
Alternative Names
VEGFA; VEGF; Vascular endothelial growth factor A; VEGF-A; Vascular permeability factor; VPF
Species
Gallus gallus (Chicken)
Source
Yeast
Expression Region
27-216
Target Protein Sequence
APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin.
Gene References into Functions
  1. BFGF or VEGF gene therapy corrects insufficiency in the intrinsic healing capacity of tendons. PMID:26865366
  2. VEGF expression in hyperoxia did not differ from normoxia on D16, yet, was actually approximately 75% higher in hyperoxia than in normoxia on day 18 PMID:26300121
  3. VEGF-A protein was decreased in cadmium treated extraembryonic membranes. PMID:26367766
  4. The results demonstrate that Vegf signaling could provide important insights into the complex relationship between bone and vasculature during intramembranous bone development. PMID:26210172
  5. These data suggest that in ovo leptin administration affects angiogenesis and embryo growth in female chicken embryos, probably through STAT3-mediated VEGF/nitric oxide pathways. PMID:22417645
  6. Homocysteine exposure causes impaired early extra embryonic vascular development, shown by altered composition of the vascular beds as well as reduced expression of VEGF-A and VEGFR-2. PMID:22085786
  7. Decrease in VEGF expression induces intussusceptive vascular pruning. PMID:21921259
  8. Short-term hypoxia transiently up-regulated VEGF146 1.5-fold at day 16 (p < 0.05). A similar trend was observed for VEGF122 (p = 0.058) and VEGF190 (p = 0.08), while no differences were present at day 19. PMID:19864924
  9. VEGF upregulates heme oxygenase-1 protein expression in vivo in chicken embryo chorioallantoic membranes by a mechanism dependent on an increase in cytosolic calcium levels and activation of protein kinase C. PMID:12788823
  10. VEGF regulates interaction of pericytes and endothelial cells during vasculogenesis and experimental angiogenesis PMID:15108306
  11. VEGF signals increases progenitor cell proliferation and decreases retinal ganglion cell genesis PMID:16672338
  12. VEGF genes and proteins are expressed at high or moderately high levels in healing tendon PMID:19084187

Show More

Hide All

Protein Families
PDGF/VEGF growth factor family
Database Links

UNIGENE: Gga.537

KEGG: gga:395909

STRING: 9031.ENSGALP00000016723

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1