Home
Product
Protein
Recombinant Proteins
Recombinant Chicken Vascular endothelial growth factor A (VEGFA)

Recombinant Chicken Vascular endothelial growth factor A (VEGFA)

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

VEGFA

Uniprot NO.

P67964

Species

Gallus gallus (Chicken)

Source

Yeast

Expression Region

27-216

Target Protein Sequence

APALGDGERKPNEVIKFLEVYERSFCRTIETLVDIFQEYPDEVEYIFRPSCVPLMRCAGC CGDEGLECVPVDVYNVTMEIARIKPHQSQHIAHMSFLQHSKCDCRPKKDVKNKQEKKSKR GKGKGQKRKRKKGRYKPPSFHCEPCSERRKHLFVQDPQTCKCSCKFTDSRCKSRQLELNE RTCRCEKPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin.

Gene References into Functions

BFGF or VEGF gene therapy corrects insufficiency in the intrinsic healing capacity of tendons. PMID:26865366
VEGF expression in hyperoxia did not differ from normoxia on D16, yet, was actually approximately 75% higher in hyperoxia than in normoxia on day 18 PMID:26300121
VEGF-A protein was decreased in cadmium treated extraembryonic membranes. PMID:26367766
The results demonstrate that Vegf signaling could provide important insights into the complex relationship between bone and vasculature during intramembranous bone development. PMID:26210172
These data suggest that in ovo leptin administration affects angiogenesis and embryo growth in female chicken embryos, probably through STAT3-mediated VEGF/nitric oxide pathways. PMID:22417645
Homocysteine exposure causes impaired early extra embryonic vascular development, shown by altered composition of the vascular beds as well as reduced expression of VEGF-A and VEGFR-2. PMID:22085786
Decrease in VEGF expression induces intussusceptive vascular pruning. PMID:21921259
Short-term hypoxia transiently up-regulated VEGF146 1.5-fold at day 16 (p < 0.05). A similar trend was observed for VEGF122 (p = 0.058) and VEGF190 (p = 0.08), while no differences were present at day 19. PMID:19864924
VEGF upregulates heme oxygenase-1 protein expression in vivo in chicken embryo chorioallantoic membranes by a mechanism dependent on an increase in cytosolic calcium levels and activation of protein kinase C. PMID:12788823
VEGF regulates interaction of pericytes and endothelial cells during vasculogenesis and experimental angiogenesis PMID:15108306
VEGF signals increases progenitor cell proliferation and decreases retinal ganglion cell genesis PMID:16672338
VEGF genes and proteins are expressed at high or moderately high levels in healing tendon PMID:19084187