Recombinant Chicken Serine/threonine-protein kinase STK11 (STK11)

Product Details

Abbreviation
STK11
Purity
>85% (SDS-PAGE)
Target Names
STK11
Uniprot NO.
Alternative Names
STK11; Serine/threonine-protein kinase STK11; EC 2.7.11.1; Liver kinase B1 homolog; LKB1
Species
Gallus gallus (Chicken)
Source
Yeast
Expression Region
1-440
Target Protein Sequence
MDMQESQQLGMFGESELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY GKVKEMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLIDGLEYLHSQGIVHKDIKPG NLLLTTNGTLKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS AGVTLYNITTGLYPFEGDNIYKLFENIGKGDFTIPEDCGPPLSDLLRGMLEYDPAKRFSI QQIRQHNWFRKKHAQAETLVPIPPSPETKDKWRSMTAVPYLEDLHGYNEDEDDDLYDIED DIIYTQDFTVPGQVPEEEAGQNGQSRGRGLPKAICMNGTEPGQLSTKSKAERRASASSNP SRKACSASSKIRKLSTCKQQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Tumor suppressor serine/threonine-protein kinase that controls the activity of AMP-activated protein kinase (AMPK) family members, thereby playing a role in various processes such as cell metabolism, cell polarity, apoptosis and DNA damage response. Acts by phosphorylating the T-loop of AMPK family proteins, leading to promote their activity.
Gene References into Functions
  1. silencing of the LKB1 tumor suppressor affects the delamination of pre-migratory cephalic neural crest cells from the neural primordium as well as their polarization and survival, thus resulting in severe facial and brain defects PMID:27527806

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, LKB1 subfamily
Tissue Specificity
Ubiquitously expressed in all tissues tested. High levels were observed in duodenum and skeletal muscle, lower levels in liver and pancreas.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1