Recombinant Chicken Protein Wnt-11 (WNT11)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
WNT11
Uniprot NO.
Species
Gallus gallus (Chicken)
Source
Yeast
Expression Region
25-354
Target Protein Sequence
IKWIALSKTPSSLALNQTQHCKQLEGLVVSQVQLCRSNLELMQTIIQAAREVIKTCRKTF SDMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHTIARACTTGDLPGCSCGPIP GETPGPGYRWGGCADNLNYGLIMGSKFSDAPMKMKKSGSQANKLMHLHNSEVGRQVLKAS LEMKCKCHGVSGSCSIKTCWKGLQELRDIALDLKNKYLSATKVVHRPMGTRKYLVPKDID IRPVKETELIYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYMDK VVERCHCKYHWCCYVTCKKCERTVERYVCK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Ligand for members of the frizzled family of seven transmembrane receptors. May play a role in the formation of dermal structure, both limb and feather buds. Is likely to signal over only few cell diameters.
Gene References into Functions
  1. Wnt11 is required for dense dermis and subsequent cutaneous appendage formation, by influencing the cell fate decision of the cells in the dorsomedial lip. PMID:24671096
  2. Wnt11 and Wnt6 act as factors maintaining the epithelial nature of the dorsomedial and ventrolateral lips of the dermomyotome, respectively, during dermomyotomal growth. PMID:16818447
  3. during early chick myogenesis WNT11 has an essential role in the oriented elongation of the myocytes PMID:18987628

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Wnt family
Tissue Specificity
Expressed in the dermatome. The expression domain is mutually exclusive to the other Wnt genes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1