Recombinant Cat Junctional adhesion molecule A (F11R), partial

Code: CSB-EP648931CA
Size:
20ug
20ug100ug1mg
US$256
Quantity:
Express system: E.coli
Species: Felis catus (Cat) (Felis silvestris catus)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Cat F11R protein, partial
Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
F11R
Uniprot NO.
Research Area
Others
Alternative Names
JAM-A;Junctional adhesion molecule 1;JAM-1;CD antigen CD321
Species
Felis catus (Cat) (Felis silvestris catus)
Source
E.coli
Expression Region
29-237aa
Target Protein Sequence
AVYTSEPDVRVPEDKPAKLSCSYSGFSNPRVEWKFAHGDITSLVCYKNKITASYADRVTFSHSGITFHSVTRKDTGTYTCMVSDDGGNTYGEVSVQLTVLVPPSKPTVHIPSSATIGSRAVLTCSEKDGSPPSEYYWFKDGVRMPLEPKGNRAFSNSSYSLNEKTGELVFDPVSAWDTGEYTCEAQNGYGMPMRSEAVRMEAAELNVGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Ligand for integrin alpha-L/beta-2 involved in memory T-cell and neutrophil transmigration. Involved in platelet activation.; (Microbial infection) May act as a cellular receptor for calicivirus.; (Microbial infection) In case of orthoreovirus infection, serves as receptor for the virus.
Gene References into Functions
  1. data provide further insight into the specific molecular interactions between fJAM-A and the FCV capsid that regulate binding and infectious entry. PMID:29386293
  2. results demonstrate that feline JAM-1 is a functional receptor for FCV, simian JAM-1 also functions as a receptor for some strains of FCV, and the interaction between FCV and JAM-1 molecules may be a determinant of viral tropism PMID:16611908
  3. JAM-1 domains required for FCV binding and infection were identified. PMID:17913818

Show More

Hide All

Subcellular Location
Cell junction, tight junction. Cell membrane; Single-pass type I membrane protein.
Protein Families
Immunoglobulin superfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products