Recombinant Candida albicans Fructose-bisphosphate aldolase (FBA1)

In Stock
Code: CSB-EP891473CZD
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
FBA1
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FBA1
Uniprot NO.
Research Area
Others
Alternative Names
FBA1; CAALFM_C401750CA; CaO19.12088; CaO19.4618Fructose-bisphosphate aldolase; FBP aldolase; FBPA; EC 4.1.2.13; 37 kDa major allergen; Fructose-1,6-bisphosphate aldolase; IgE-binding allergen
Species
Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Source
E.coli
Expression Region
2-359aa
Target Protein Sequence
APPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQTSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFDGMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGGEEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEILGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGIRDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Expressing the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein in e.coli cells involves inserting a DNA fragment encoding the Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein (2-359aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the FBA1 protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The cells are lysed to collect the recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Candida albicans (strain SC5314 / ATCC MYA-2876) FBA1 protein exceeds 85%.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3-phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis.
Gene References into Functions
  1. To test if Fba1p is an antifungal target, the effects of depleting this enzyme in Candida albicans was investigated using a methionine/cysteine-conditional mutant (MET3-FBA1/fba1); and it was found that Fba1p is required for the growth of C. albicans. PMID:16896220

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Class II fructose-bisphosphate aldolase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products