MGGDLTVKMLGGQEILVPLRDSMTVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVLQGLRAGSTVLLVVQNCISILVRNDKGRSSPYEVQLKQTVAELKQQVCQKERVQADQFWLSFEGRPMDDEHPLEEYGLMKGCTVFMNLRLRGG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.4 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Exhibits antiviral activity towards both DNA and RNA viruses. The secreted form of ISG15 can: induce natural killer cell proliferation, augment lymphokine-activated-killer (LAK) activity, induce dendritic cell maturation, act as a chemotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity. The secreted form acts through the integrin ITGAL/ITGB2 receptor to initiate activation of SRC family tyrosine kinases including LYN, HCK and FGR which leads to secretion of IFNG and IL10; the interaction is mediated by ITGAL. In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy.
Gene References into Functions
Data suggest that ISG15 is involved in early blastocyst/embryo development; ISG15 appears to regulate gene expression in developing blastocyst; specifically, ISG15 is required for up-regulation of IFNT expression in blastocyst development. (ISG15 = ubiquitin-like protein ISG15, interferon-stimulated gene 15 protein; IFNT = interferon-tau)PMID:27165775
ISG 15 gene expression is upregulated during 16-18 days of pregnancy and could be used as an early pregnancy marker in dairy cows, especially in heifers.PMID:27766692
ISG15, UBE1l and UBCH8 genes are significantly upregulated in the artificially inseminated pregnant cows.PMID:27802914
Data indicate that the expression profiles of ISG15, MX1, MX2, and OAS1 could be a useful diagnostic biomarker of gestation.PMID:23384108
Bovine herpesvirus 1 protein bICP0 represses the transcription of bISG15 in fetal bovine lung cells.PMID:22160940
ISG15 is an antiviral and inducible protein in bovine immunodeficiency virus infected bovin lung cells.PMID:20569475
ISG15 and conjugated proteins were expressed in corpus luteum of both cyclic and pregnant cows regardless of pregnancy status and were upregulated during early pregnancyPMID:20172220
interferon-stimulated protein(ISG15) was localized throughout the endometrium on day 18-23 of bovine pregnancy and was specifically localized to organelles and compartments of endometrial epithelial cells and stromal cellsPMID:14563704
rbovISG15 is unstable over time in storage & dialysis. In vivo, conjugation of ISG15 to targeted proteins occurs inside the cell.PMID:17223698
Show
More
Hide
All
Subcellular Location
Cytoplasm. Secreted.
Tissue Specificity
Expressed in endometrium and uterine flushings of pregnant cow. Also secreted. Not detected in spleen, liver, corpus luteum or muscle.