Recombinant Bovine Troponin I, cardiac muscle (TNNI3)

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TNNI3
Uniprot NO.
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
2-212
Target Protein Sequence
ADRSGGSTAGDTVPAPPPVRRRSSANYRAYATEPHAKKKSKISASRKLQLKTLMLQIAKQ ELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDVEAKVT KNITEIADLNQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKETLDLRAHLKQVKKE DTEKENREVGDWRKNIDALSGMEGRKKKFEG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
Gene References into Functions
  1. An Ala8Val mutation enhances the effect of cardiac troponin I pseudophosphorylation on the rate of dissociation of calcium from reconstituted thin filaments. PMID:22489623
  2. Serum cardiac troponin I cannot be used to distinguish cattle with pericarditis from cattle with other primary cardiac diseases or noncardiac, intrathoracic disorders. PMID:19496907

Show More

Hide All

Protein Families
Troponin I family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1