Recombinant Bovine Toll-like receptor 6 (TLR6)

Product Details

Abbreviation
TLR6
Purity
>85% (SDS-PAGE)
Target Names
TLR6
Uniprot NO.
Alternative Names
TLR6; Toll-like receptor 6; EC 3.2.2.6; CD antigen CD286
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
24-584
Target Protein Sequence
TIIQFSDESEFVVDMSKTSLIHVPKDLPPKTKVLDLSQNNISELHLSDISFLSGLRVLRL SHNRIQGLDISIFKFNHDLEYLDLSHNQLQKISCHPITTTLKHLDLSFNDFDALPICKEF GNLTQLNFLGLSATKLQQLDLLPIAHLHLSCILLDLEDYMKENKKESLQILNTKKLHLVF HPNSFFSVQVDISANSLGCLQLTNIKLNDYNCQVLLKFLSGLTGGPTLLNFTLNHVETTW KCLVKVFQFLWPKPIEYLNIYNLTIVESIDEEVFTYYKTTLKALKIEHITNKVFIFSQTA LYTVFSEMNILMLTISDTRFIHMLCPQEPSTFKFLNFTQNSFTDSVFQNCDTLARLETLI LQKNELKDLFKTSLMTKDMLSLETLDVSWNSLEYDRSNGNCSWVGSIVVLNLSSNALTDS VFRCLPPRIKVLDLHNNRIRSIPKDVTGLETLQELNLASNSLAHLPGCGIFSSLSILIIE HNSISNPSADFFQSCQKIRSLKAGNNPFQCSCELRDFIQSVGQVSSDVVEGWPESYKCDY PESYKGTPLKDFQVSELSCNT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Extracellular domain
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Participates in the innate immune response to Gram-positive bacteria and fungi. Specifically recognizes diacylated and, to a lesser extent, triacylated lipopeptides. In response to diacylated lipopeptides, forms the activation cluster TLR2:TLR6:CD14:CD36, this cluster triggers signaling from the cell surface and subsequently is targeted to the Golgi in a lipid-raft dependent pathway. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR2. In complex with TLR4, promotes sterile inflammation in monocytes/macrophages in response to oxidized low-density lipoprotein (oxLDL) or amyloid-beta 42. In this context, the initial signal is provided by oxLDL- or amyloid-beta 42-binding to CD36. This event induces the formation of a heterodimer of TLR4 and TLR6, which is rapidly internalized and triggers inflammatory response, leading to the NF-kappa-B-dependent production of CXCL1, CXCL2 and CCL9 cytokines, via MYD88 signaling pathway, and CCL5 cytokine, via TICAM1 signaling pathway, as well as IL1B secretion.
Gene References into Functions
  1. Variants in the TLR6 gene are associated with susceptibility to bovine TB. PMID:25017737
  2. TLR2, TLR1, and TLR6 haev roles in innate immunity and initiate inflammatory responses to bacterial lipopeptides by epithelial and stromal cells of bovine endometrium PMID:24437488
  3. The expression analysis showed similar expression profiles for TLR1 and TLR6, which indicate a co-regulation of these two genes, TLR10 had a different expression profile, pointing toward a stronger functional diversification compared to TLR1 and TLR6. PMID:16950576
  4. Analysis of sequence variability and protein domain architectures for bovine peptidoglycan recognition protein 1 and Toll-like receptors 2 and 6. PMID:18639626

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasmic vesicle, phagosome membrane; Single-pass type I membrane protein. Membrane raft. Golgi apparatus.
Protein Families
Toll-like receptor family
Tissue Specificity
Highest expression levels seen in blood and lymph node, intermediate expression seen in spleen and lowest expression seen in the liver, lung and udder cistern.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1