Recombinant Bovine TNF receptor-associated factor 6 (TRAF6)

Product Details

Abbreviation
TRAF6
Purity
>85% (SDS-PAGE)
Target Names
TRAF6
Uniprot NO.
Alternative Names
TRAF6; TNF receptor-associated factor 6; EC 2.3.2.27; E3 ubiquitin-protein ligase TRAF6; RING-type E3 ubiquitin transferase TRAF6
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
1-542
Target Protein Sequence
MSLLHCENSCGSSQSESDCCAAMAASSCGTAAKDDSVSGTASTVTLSSSFMEEIQGYDVE FDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFP DNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQCQRPFQKCHLNIHIL KECPRRQVPCENCAVSMAFEDKEIHEQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAP VPCTFSAFGCHEKMQRNHLARHLQENTQSHMRMMAQAVQTLSLAVAPVPQCTMPLYDSVP PTRPSSGRHSEVHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVNELKRTIRTLEDK VAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSA QRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAAVRQNHEEIMDAKPELLAFQ RPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDS GI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
E3 ubiquitin ligase that, together with UBE2N and UBE2V1, mediates the synthesis of 'Lys-63'-linked-polyubiquitin chains conjugated to proteins, such as IKBKG, IRAK1, AKT1 and AKT2. Also mediates ubiquitination of free/unanchored polyubiquitin chain that leads to MAP3K7 activation. Leads to the activation of NF-kappa-B and JUN. Seems to also play a role in dendritic cells (DCs) maturation and/or activation. Represses c-Myb-mediated transactivation, in B-lymphocytes. Adapter protein that seems to play a role in signal transduction initiated via TNF receptor, IL-1 receptor and IL-17 receptor. Regulates osteoclast differentiation by mediating the activation of adapter protein complex 1 (AP-1) and NF-kappa-B, in response to RANK-L stimulation. Together with MAP3K8, mediates CD40 signals that activate ERK in B-cells and macrophages, and thus may play a role in the regulation of immunoglobulin production.
Subcellular Location
Cytoplasm. Cytoplasm, cell cortex. Nucleus. Lipid droplet.
Protein Families
TNF receptor-associated factor family, A subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1