Recombinant Bovine Synaptonemal complex protein 3 (SYCP3)

Product Details

Abbreviation
SYCP3
Purity
>85% (SDS-PAGE)
Target Names
SYCP3
Uniprot NO.
Alternative Names
SYCP3; Synaptonemal complex protein 3; SCP-3
Species
Bos taurus (Bovine)
Source
Yeast
Expression Region
1-225
Target Protein Sequence
MVPSGRKHSGKLAKPSVGDQAIRAYEFEQEDKKDLSGSEEDAIEEKTPTLEKQGKKRTSA AVEDMGGEVQNMLERFGADINKSLLAKRKRLEMYTKASLKTSNQKLENVWKIQQEQRQKL NQEYSQQFLTLFQQWDIDMQKAEEQEEKLANLFRQQQKVFQQSRIVQSQRLKTIRQLYEQ FIKSMEDLEKNHENLLTGAQNELKKEMALLQKKIMMETVSCYSEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for centromere pairing during meiosis in male germ cells. Required for normal meiosis during spermatogenesis and male fertility. Plays a lesser role in female fertility. Required for efficient phosphorylation of HORMAD1 and HORMAD2.
Subcellular Location
Nucleus. Chromosome. Chromosome, centromere.
Protein Families
XLR/SYCP3 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1