Home
Product
Protein
Recombinant Proteins
Recombinant Bovine Insulin-like growth factor II (IGF2), partial

Recombinant Bovine Insulin-like growth factor II (IGF2), partial

In Stock

Code: CSB-YP011088BO

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$276

Quantity:

Express system: Yeast

Species: Bos taurus (Bovine)

Tag Info: N-terminal hFc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

IGF2

Uniprot NO.

P07456

Research Area

Cancer

Species

Bos taurus (Bovine)

Source

Yeast

Expression Region

25-91aa

Target Protein Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.1 kDa

Protein Length

Partial

Tag Info

N-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.

Gene References into Functions

Methylation pattern in a CpG island of the IGF2 gene in cumulus cells from 1-3 mm and >/= 8.0 mm follicles and the effects of in vitro maturation on this pattern. PMID:24174298
Our results provide evidence that polymorphisms in the IGF2 gene are associated with growth traits, and may be used for marker-assisted selection in beef cattle breeding program PMID:24374893
The identification of the polymorphisms in the IGF2 gene that were significantly associated with growth traits in cattle. PMID:23957672
Polymorphisms in the IGF2 gene are associated with cattle growth traits. PMID:23900197
The LEP, IGF2 and CCL2 genes showed allelic expression imbalance in liver, kidney and pituitary glands of Polish Holstein-Friesian bulls. PMID:23184004
Sex-sorting procedure by flow cytometry did not affect the overall DNA methylation patterns of the IGF2 and IGF2R genes, although individual variation in their methylation patterns among bulls was observed. PMID:22128039
The reduction in IGFs mRNA level after 5 days of life in the duodenum (IGF-1 and IGF-2) and in the jejunum (IGF-1) was associated with reduction in villi length (duodenum and jejunum) and the increase of crypt depth (duodenum). PMID:22439332
Changes in the methylation pattern of IGF2 during in vitro maturation were different between incompetent and competent oocytes, and this characteristic may be useful as a molecular marker in studies of oocyte competence in cattle. PMID:20833870
Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID:21056085
findings support work which suggests that the insulin-like growth factor 2 locus is an important biological regulator of milk production in dairy cattle PMID:20822563
effects of insulin, IGF-I and IGF-II on apoptosis and cell proliferation in bovine blastocysts in vitro PMID:12112582
IGF2 is subjected to extensive transcriptional regulation through multiple promoters, alternative splicing and polyadenylation, as well as genetic imprinting.IGF2 regulation is age-, tissue-, promoter-, and allele-specific PMID:16120826
Identification of a previously unknown differentially methylated region in exon 10 of the bovine IGF2 gene. PMID:16644179
Indel polymorphism associated with breeding value in bulls. PMID:17242995
The role of insulin-like growth factor 2 (IGF2) and the regulation of the IGF2 receptor (IGF2R) during follicular development were studied. PMID:17360960
Embryonic tissues from NT-derived embryos had higher expression of IGF-II mRNA than in vitro production embryonic tissues. PMID:17628655
The effect of single nucleotide polymorphisms in 6 genes and their associations with production factors in beef cattle are reported. PMID:17785604
study to assess the mRNA expression of IGF-I, IGF-II, IGF-IR and IGF-IIR in bovine oocytes and different stages of preimplantation embryos PMID:19013732
Dats detected that SNPs of IGF2 gene has close relationship with carcass and meat quality traits in Qinchuan cattle PMID:19073573
Hypomethylation trends in the intergenic region of the imprinted IGF2 and H19 genes in cloned cattle. PMID:19282114
Among embryos developing in vivo, the level of DNA methylation in the IGF2 intragenic DMR was significantly lower in female than in male blastocysts PMID:19341790