Recombinant Betula pendula Profilin-1 (BETVII)

In Stock

Code: CSB-EP335151BSS

Rate （N/A）
Review （0）
Citation （1）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$388

Quantity:

Express system: E.coli

Species: Betula pendula (European white birch) (Betula verrucosa)

Tag Info: N-terminal 6xHis-SUMO-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

BETVII

Uniprot NO.

P25816

Research Area

Allergen

Alternative Names

BETVII; Profilin-1; Allergen Bet v II; Pollen allergen Bet v 2; allergen Bet v 2

Species

Betula pendula (European white birch) (Betula verrucosa)

Source

E.coli

Expression Region

2-133aa

Target Protein Sequence

SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

30.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

I have question regarding Recombinant Betula pendula Profilin(BETVII) CODE: CSB-EP335151BSS, you wrote that this protein is tagged "The tag of this protein is N-terminal 6xHis-SUMO-tagged". For what purpose is this protein tagged? What do you think, if this protein wil be good for preparation of calibration curve with your BETVII Antibody (CODE: CSB-PA335151HA01BSS) in ELISA assay and as positive control in western blot during research concerning detection of profilin homologoues in plant extracts? Or will be better to remove this tag for above mentioned research? You wrote that, you could provide tag removal service.

Thanks for your inquiry.
1. The purpose of this protein tag is used for help the solubility express.
2. You can use CSB-EP335151BSS with CSB-PA335151HA01BSS in ELISA assay.
3. CSB-EP335151BSS can be used as positive control in western blot in theroy.Pls refer to the following link:
http://www.ebi.ac.uk/thornton-srv/databases/cgi-bin/pdbsum/GetPage.pl?pdbcode=1CQA
https://www.ncbi.nlm.nih.gov/pubmed/9420135?dopt=Abstract

Citations

Suitability of Selected Apple Varieties for People with Allergies and Diabetes M Aninowski,/,2024

Target Background

Function(From Uniprot)

Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.

Subcellular Location

Cytoplasm, cytoskeleton.

Protein Families

Profilin family

Promotions