Recombinant Arabidopsis thaliana Phosphomethylethanolamine N-methyltransferase (NMT2)

Product Details

Abbreviation
NMT2
Purity
>85% (SDS-PAGE)
Target Names
NMT2
Uniprot NO.
Alternative Names
NMT2; PMEAMT; At1g48600; T1N15.22/T1N15.23; T1N15_20Phosphomethylethanolamine N-methyltransferase; AtPMEAMT; EC 2.1.1.-; Phosphoethanolamine N-methyltransferase 2
Species
Arabidopsis thaliana (Mouse-ear cress)
Source
Yeast
Expression Region
2-491aa
Target Protein Sequence
ATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKEVELMAERMIGWVKPGGYIFFRESCFHQSGDSKRKSNPTHYREPRFYTKVFQECQTRDASGNSFELSMVGCKCIGAYVKNKKNQNQICWIWQKVSVENDKDFQRFLDNVQYKSSGILRYERVFGEGYVSTGGFETTKEFVAKMDLKPGQKVLDVGCGIGGGDFYMAENFDVHVVGIDLSVNMISFALERAIGLKCSVEFEVADCTTKTYPDNSFDVIYSRDTILHIQDKPALFRTFFKWLKPGGKVLITDYCRSAETPSPEFAEYIKQRGYDLHDVQAYGQMLKDAGFDDVIAEDRTDQFVQVLRRELEKVEKEKEEFISDFSEEDYNDIVGGWSAKLERTASGEQKWGLFIADKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes N-methylation of phosphomonomethylethanolamine and phosphodimethylethanolamine, the two methylation steps required to convert phosphomonoethanolamine to phosphocholine. Unlike NMT1, NMT2 cannot utilize phosphoethanolamine as substrate in vitro.
Gene References into Functions
  1. phosphomethylethanolamine N-methyltransferase is involved in Arabidopsis choline and phospholipid metabolism. PMID:20650897

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, PEAMT family
Database Links

UNIGENE: At.22426

KEGG: ath:AT1G48600

STRING: 3702.AT1G48600.2

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1