Purity
Greater than 85% as determined by SDS-PAGE.
Species
Apis mellifera (Honeybee)
Expression Region
34-167aa
Target Protein Sequence
IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMYFNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer，50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Recombinant Apis mellifera Phospholipase A2 was produced in E.coli, where the gene sequence encoding Apis mellifera Phospholipase A2 (34-167aa) was expressed with the N-terminal 6xHis tag. The purity of this Phospholipase A2 was greater than 85% by SDS-PAGE.
Phospholipase A2, abbreviated as PLA2, is a class of enzymes with its primary function being the hydrolysis of phospholipids, a major type of lipid present in cell membranes, to produce free fatty acids and soluble phospholipids. This process plays a crucial role in the metabolism of cell membranes, cell signal transduction, and inflammatory responses.
PLA2 also plays a role in the defense mechanisms of bees. Bee stings contain venom that includes proteins like PLA2, which are used to defend against predators. These proteins may cause the cell membranes of adversaries to rupture, leading to pain and an inflammatory response.
Proteins like PLA2 are also of significant value in medical research because they are associated with inflammatory conditions, neurological disorders, and other diseases. Some drugs and treatment approaches target PLA2 enzymes in the search for ways to treat inflammatory diseases.
