Recombinant Rat Collagen alpha-1 (I) chain, partial

Code: CSB-YP005727RA
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: Yeast
Species: Rattus norvegicus (Rat)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Col1a1
Uniprot NO.
Research Area
Others
Alternative Names
Alpha-1 type I collagen
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
955-1207aa
Target Protein Sequence
QRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Type I collagen is a member of group I collagen (fibrillar forming collagen).
Gene References into Functions
  1. the activation of Pin1 promoted cardiac extracellular matrix deposition and oxidative stress damage by regulating the phosphorylation of the MEK1/2ERK1/2 signaling pathway and the expression of alphaSMA. PMID:29286102
  2. In vitro analysis using LX2 HSC cells indicated that ATII can augment TGFbeta1 and collagen type I alpha1 mRNA expression via periostin expression, suggesting that the interaction between ATII and periostin may serve a role in liver fibrosis development. In conclusion, blockade of ATIIinduced periostin may suppress the progression of liver fibrosis development. PMID:28849131
  3. miR21 regulates expression of alphaSMA and collagen I in activated rat hepatic stellate cells by directly targeting Smad7. PMID:28731181
  4. Taken together, the lentiviral RNAi vector targeting the TGF beta-1 gene of rats was successfully constructed, which effectively silenced the TGF beta-1 gene of the HSCT6 cells and inhibited the expression of Col1a1. PMID:28713909
  5. the diagnostic value of urinary collagen degradation products in a proteinuria-driven fibrosis rat model, was investigated. PMID:28320405
  6. Brefeldin A induced a significant up-regulation of Col1a1 mRNA levels in CFSC-2G hepatic stellate cells that was time-dependent. The UPR correlated with enhanced mRNA and protein levels of collagen type I in these cells. Analysis of the 3 branches of UPR revealed the activation of IRE1alpha, PERK and ATF6 in response to BFA. An IRE1alpha-p38 MAPK-Smad pathway may be responsible for the fibrogenic action of BFA on HSC. PMID:27155082
  7. treatment with LG ameliorated STZ-induced DN via the inhibition of oxidonitrosative stress as well as downregulation of KIM-1, NGAL, TGF-beta1, and collagen-1 mRNA expressions. PMID:27756197
  8. In a liver fibrosis cellular model, tenascin-C promotes migration of hepatic stellate cells and production of type I collagen via TGF-beta1 and alpha9beta1 integrin pathway. PMID:27031437
  9. Liganded vitamin D receptor through its interacting repressor inhibits the expression of Col1a1. PMID:27351590
  10. In a pure VO model, chymase produced in adult cardiac fibroblasts leads to autophagic degradation of newly synthesized intracellular procollagen I, suggesting a new role of chymase in extracellular matrix degradation PMID:26807691
  11. signaling through Na/K-ATPase regulates miRNAs and specifically, miR-29b-3p expression both in vivo and in vitro. PMID:26702050
  12. A reciprocal regulatory relationship between DDR2 and collagen, involving cross-talk between the GPCR and RTK pathways, is central to Angiotensin II-induced increase in collagen expression in cardiac fibroblasts. PMID:26674152
  13. Preferential sites for intramolecular glucosepane cross-link formation in type I collagen has been described. PMID:26049074
  14. The present findings suggest that prolyl 3-hydroxylation incrementally regulates collagen fibril diameter in tendon. PMID:26567337
  15. Flouride affected collagen I arrangement and produced ultrastructural changes in bone tissue. Meanwhile, the mRNA expression of COL1A1 and COL1A2 were reduced and the COL I protein levels decreased in the fluorosis group. PMID:25655816
  16. High Collagen Type I expression is associated with renal fibrosis in experimental kidney diseases. PMID:25784725
  17. Increased expression of Acan and Col2a1 along with decreased expression of Col1a1 and Mmp13 indicated formation of hyaline cartilage in this group. PMID:25128628
  18. These data support the hypotheses that, in dentin, the interaction between COL1 and PP may initiate crystal nucleation and that additional interactions between PP and the growing crystals may modulate the crystal growth pattern and crystal size. PMID:15609627
  19. Fetal and adult human skin fibroblasts retain their differential proliferative response to TGF-beta when cultured in the presence of fibronectin and unpolymerized or polymerized collagen. PMID:24735795
  20. Regional differences in cell proliferation and fibronectin structure were dependent on both soluble fibronectin concentration and fibronectin-collagen type I interactions. PMID:24116223
  21. This study suggests that laminin and type I collagen support the function of folliculostellate cells by increasing fibromodulin protein expression in the anterior pituitary. PMID:23959432
  22. The naive effector cells of collagen type I during acute experimental pancreatitis are acinar cells and not pancreatic stellate cells PMID:24036265
  23. Data suggest that miR-711-SP1-collagen-I pathway may be strategies for miRNA-based anti-fibrotic drug research. PMID:23633075
  24. The DNMT-mediated DNA methylation is an important mechanism in regulating the TGF-beta1-induced COL1A1 gene expression. PMID:23560091
  25. Hypothesized that reducing collagen I accumulation in glomerulosclerosis would lower Hic-5 expression,reducing apoptosis, and maintain glomerular integrity. NTU281 treatment reduced glomerular col I accumulation, Hic-5 and alpha-SMA expression, and apoptosis. PMID:23508044
  26. These findings suggest that amide I nonlinear optical chiral effects in type I collagen assemblies arise predominantly from the chiral organization of amide chromophores within individual collagen molecules, rather than from supramolecular structures. PMID:23200051
  27. Hypoxia alone can upregulate DNA synthesis and expression of collagen type I and III mRNA in adult rat cardiac fibroblasts. PMID:21166192
  28. Crystal structures of Hsp47 in its free form and in complex with homotrimeric synthetic collagen model peptides, are presented. PMID:22847422
  29. Curcumin could suppress bleomycin-induced pulmonary fibrosis by inhibiting the synthesis and deposition of type I collagen and reducing expression of TGF-beta1. PMID:18727865
  30. These data demonstrate a relationship between miR-133a and Col1A1, suggesting that myocardial fibrosis occurring in Ang II-dependent hypertension is regulated by the down-regulation of miR-133a and miR-29b through the modulation of Col1A1 expression. PMID:21769867
  31. S-adenosyl-L-methionine inhibits Col1A1 processing leading to increased ubiquitination and decreased secretion. PMID:21645221
  32. The regulatory effect of melatonin (MLT)cannot be explained by its effect on procollagen gene expression, since neither MLT nor pinealectomy is shown to have an influence on alpha1 (I) and alpha1 (III) procollagen mRNA content in the scar. PMID:20388018
  33. High fat diet reduces the levels of type I tropocollagen and adiponectin and these effects are deleterious for skin function. PMID:20397200
  34. Bushen Rougan Recipe can decrease the expressions of collagen type I and CTGF mRNAs in rats with hepatic fibrosis. PMID:18782537
  35. Craniofacial growth and type I collagen gene expresion in the rat occur mainly between days 10 and 21. PMID:20149607
  36. AT2 receptor is involved in collagen metabolism in cardiac fibroblasts by regulating the levels of Col I and TIMP-1 mRNA. PMID:18095594
  37. Data support that post-translational glycosylation of collagen I has a role in the induction in endothelial cells in vitro of molecules conductive to self-organization in vessels-like structures. PMID:20006603
  38. Deducted interpretations from our experimental approach suggest that Ang II stimulates indirectly (via SNS) and inhibits directly (via AT1 receptors) the collagen type I at transcriptional and protein levels. PMID:19679517
  39. Type I collagen gene expression is affected by mechanical loading. PMID:11924646
  40. Gene expression of TGF-beta1, type I collagen, and connective tissue growth factor using primary cultured pancreatic stellate cells. PMID:12199527
  41. p38 MAPK mediates the regulation of alpha1(I) procollagen mRNA levels by TNF-alpha and TGF-beta in a cell line of rat hepatic stellate cells PMID:12297293
  42. hypoxic enhancement of the posttranscriptional step of collagen synthesis contributed to the accelerated deposition of collagen fibrils PMID:12408871
  43. dental pulp contains competent progenitor cells capable of differentiating into new generations of odontoblast-like cells which express high levels of Col1a1-2.3-GFP PMID:12755333
  44. TRAM2, as a part of the translocon, is required for the biosynthesis of type I collagen by coupling the activity of SERCA2b with the activity of the translocon PMID:14749390
  45. both p38 MAPK and Smad signaling independently and additively regulate alpha1(I) collagen gene expression by transcriptional activation PMID:15647278
  46. Results show that 70-kDa ribosomal S6 kinase plays a crucial role in hepatic stellate cell proliferation, collagen type I expression, and cell cycle control, thus representing a potential therapeutic target for liver fibrosis. PMID:15677443
  47. Results conclude that residues 19-46 of bone sialoprotein represent a novel collagen-binding site. PMID:15703183
  48. Endo180 binds to the C-terminal region of type I collagen, and this interaction appears to play an important role in cell-matrix adhesion PMID:15817460
  49. Our results demonstrate that inhibition of alphaI(I)-collagen gene expression by curcumin in activated HSCs results from suppression of CTGF gene expression through increasing cellular GSH contents and interruption of TGF-beta signaling. PMID:16306131
  50. Data present a crystallographic determination of the collagen type I supermolecular structure. PMID:16751282

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Fibrillar collagen family
Tissue Specificity
Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.
Database Links

UNIGENE: Rn.2953

KEGG: rno:29393

STRING: 10116.ENSRNOP00000005311

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products