Abbreviation
Recombinant Mouse Cd40 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40 at 2 μg/mL can bind Mouse Cd40lg(CSB-MP004937MO1).The EC50 is 5.121-6.085 ng/mL.
Alternative Names
Tumor necrosis factor receptor superfamily member 5; B-cell surface antigen CD40; Bp50; CD40L receptor; CD40; Cd40; Tnfrsf5
Species
Mus musculus (Mouse)
Expression Region
20-193aa
Target Protein Sequence
LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Mouse Cd40 at 2 μg/ml can bind Mouse Cd40lg(CSB-MP004937MO1).The EC50 is 5.121-6.085 ng/mL.
Description
CD40 signaling drives critical co-stimulatory pathways in B cells, dendritic cells, and macrophages, making this receptor a central node in adaptive immunity and a validated target in cancer immunotherapy and autoimmune disease research. This mammalian-expressed construct spanning residues 20–193 captures the complete extracellular ligand-binding domain and demonstrates quantifiable binding to mouse CD40LG with an EC50 of 5.1–6.1 ng/mL in functional ELISA, providing a validated reagent for ligand-receptor interaction studies, competitive inhibition assays, and blocking antibody screening campaigns. The measured affinity supports use in surface plasmon resonance and biolayer interferometry experiments for therapeutic antibody epitope mapping, as well as small-molecule or biologic inhibitor screening in drug discovery workflows targeting the CD40–CD40L axis. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in functional binding assays and cell-based co-stimulation studies.
