Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
Alternative Names
Shh; Hhg1; Sonic hedgehog protein; SHH; HHG-1; Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains; ShhNC) [Cleaved into: Sonic hedgehog protein N-product; ShhN; Shh N-terminal processed signaling domains; ShhNp; Sonic hedgehog protein 19 kDa product)]
Species
Mus musculus (Mouse)
Expression Region
25-198aa
Target Protein Sequence
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
Dive into cancer research with Recombinant Mouse Sonic Hedgehog Protein (Shh), a key component in the Hedgehog signaling pathway involved in embryonic development and tumorigenesis. This partial protein, expressed in E. coli, covers the 25-198aa region of Shh and is provided tag-free. With a purity of over 95%, as verified by SDS-PAGE, and endotoxin levels below 1.0 EU/µg, this lyophilized powder is suitable for a range of research applications. The functional ELISA activity demonstrates an ED50 of less than 90 µg/ml in its ability to bind Human BOC, supporting the protein's high level of biological activity.