Recombinant Mouse Sonic hedgehog protein (Shh), partial (Active)

In Stock Discontinued
Code: CSB-AP005791MO
Size:
10ug
10ug50ug500ug1mg(1mg*1 or 500ug*2)
US$204
Quantity:
Express system: E.coli
Species: Mus musculus (Mouse)
Tag Info: Tag-Free
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
Target Names
Shh
Uniprot NO.
Research Area
Cancer
Alternative Names
Shh; Hhg1; Sonic hedgehog protein; SHH; HHG-1; Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains; ShhNC) [Cleaved into: Sonic hedgehog protein N-product; ShhN; Shh N-terminal processed signaling domains; ShhNp; Sonic hedgehog protein 19 kDa product)]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
25-198aa
Target Protein Sequence
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Partial
Tag Info
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

Dive into cancer research with Recombinant Mouse Sonic Hedgehog Protein (Shh), a key component in the Hedgehog signaling pathway involved in embryonic development and tumorigenesis. This partial protein, expressed in E. coli, covers the 25-198aa region of Shh and is provided tag-free. With a purity of over 95%, as verified by SDS-PAGE, and endotoxin levels below 1.0 EU/µg, this lyophilized powder is suitable for a range of research applications. The functional ELISA activity demonstrates an ED50 of less than 90 µg/ml in its ability to bind Human BOC, supporting the protein's high level of biological activity.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
The C-terminal part of the sonic hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity. Both activities result in the cleavage of the full-length protein into two parts (ShhN and ShhC) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated ShhN. Both activities occur in the reticulum endoplasmic. Once cleaved, ShhC is degraded in the endoplasmic reticulum.; The dually lipidated sonic hedgehog protein N-product (ShhNp) is a morphogen which is essential for a variety of patterning events during development. Induces ventral cell fate in the neural tube and somites. Involved in the patterning of the anterior-posterior axis of the developing limb bud. Essential for axon guidance. Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. In the absence of SHH, PTCH1 represses the constitutive signaling activity of SMO.
Gene References into Functions
  1. quiescent dental stem cells are regulated by Shh signaling. PMID:28547659
  2. show that eliminating mouse MACS1 causes severe defects in laryngeal development, indicating that MACS1-directed Shh signalling is indispensable for respiratory organogenesis PMID:28155855
  3. Results suggest distinct functions of tuberous sclerosis complex 1 protein (Tsc1) and tuberous sclerosis complex 2 protein (Tsc2) in cellular signaling as the two genes affect ciliary length control and sonic hedgehog protein signaling via different mechanisms. PMID:29396625
  4. The results of this study indicated that Shh, Sfrp1, and Wnt5a collaborate to direct the pathfinding of descending 5-HT axons in the brainstem. PMID:29196093
  5. data illustrate that persistent Hh signaling in the palatal epithelium contributes to the etiology and pathogenesis of submucous cleft palate through its interaction with a p63/Irf6-dependent biological regulatory loop and through a p63-induced cell adhesion network. PMID:29981310
  6. SOX2 functions downstream of HH signaling to regulate lingual epithelium homeostasis. PMID:29945863
  7. High SHH expression is associated with medulloblastoma formation. PMID:29378965
  8. Identify SMO-dependent Shh signalling as a specific process for the activation of adventitial fibroblasts and the subsequent proliferation of smooth muscle cells and neointima formation. PMID:29088375
  9. In the mutant Hammer toe (Hm) genome, a 150-kb noncoding DNA fragment from chromosome 14 is inserted into the region upstream of the Sonic hedgehog (Shh) promoter in chromosome 5. Two different regions are necessary for the syndactyly phenotype of Hm. PMID:29255029
  10. Data show that Sonic hedgehog (Shh), which encodes a secreted protein signal, is expressed in the sensory neurons, and that experimental ablation of neuronal Shh expression causes loss of taste receptor cells (TRCs). PMID:29279401
  11. Here by inducing expression of constitutively active Smoothened (SmoM2) or Gli2 (DeltaNGli2) in the adipocyte lineage of postnatal mice, the authors show that targeted activation of Hedgehog signaling suppresses high-fat-diet-induced obesity and improves whole-body glucose tolerance and insulin sensitivity. PMID:29205155
  12. These data suggest a potential novel mechanism in which alterations in SHH variance during evolution may have driven changes in limb patterning and digit length. PMID:28131983
  13. Epithelial-mesenchymal transition programs promote basal mammary stem cell and tumor-initiating cell stemness by inducing primary ciliogenesis and Hedgehog signaling. PMID:29158396
  14. the knockdown of Ihh suppressed osteoblast growth and differentiation via a mechanism which may be associated with the TGF-beta/Smad and OPG/RANKL signaling pathways. PMID:28990069
  15. SHH signaling regulates the direction of cerebellar granule cells division. PMID:28633908
  16. The authors report here that Sonic Hedgehog (Shh)-Smoothened signaling downregulates Shisa2, which inhibits the glycosylation and cell surface presentation of Frizzled3 in rodent commissural axon growth cones. PMID:28885142
  17. ESP of fifth-stage larval Angiostrongylus cantonensis stimulates astrocyte activation and IL-1beta and IL-6 production through NF-kappaB and the Shh signaling pathway. PMID:28950910
  18. results indicate for the first time a possible mechanism involved in the crosstalk between fibroblasts and osteoblasts, as it was possible to observe trophic factors released by fibroblasts interfering decisively in osteoblast metabolism in a Shh-independent manner. PMID:28578539
  19. Importantly, Scube2 uncouples processing of Shh peptides from their lipid-mediated juxtamembrane positioning, and thereby explains the long-standing conundrum that N-terminally unlipidated Shh shows patterning activity in Scube2-expressing vertebrates PMID:28778988
  20. Shh signaling requires the coordinated activity of Sulf1 and Sulf2 in order to reach that threshold in the mouse ventral spinal cord PMID:28490013
  21. SHH-dependent activation of WNT signaling supports regeneration of the cortex following long-term glucocorticoid treatment. PMID:29211850
  22. by acting upstream of Shh signaling pathway, Barhl2 plays a crucial role in patterning the progenitor domains and establishing the positional identities of progenitor cells in the diencephalon. PMID:27349434
  23. Gli3 activity in mouse thymic epithelial cells (TECs) promotes positive selection and differentiation from CD4(+) CD8(+) to CD4(+) CD8(-) single-positive (SP4) cells in the fetal thymus and Gli3 represses Shh constitutive deletion of Gli3, and conditional deletion of Gli3 from TECs, reduced differentiation to SP4, whereas conditional deletion of Gli3 from thymocytes did not PMID:29361554
  24. The present study shows a new role for Maml1 as a component of Shh signaling, which plays a crucial role in both development and tumorigenesis. PMID:28726779
  25. Sonic Hedgehog Activates Phospholipase A2 to Enhance Smoothened Ciliary Translocation PMID:28591579
  26. smaller mvShh conjugates resulted in faster wound resolution compared to the unconjugated Shh. This study is the first to show how the wound healing efficacy of multivalent protein-polymer conjugates is sensitive to the polymer MW, and our findings suggest that this parameter could be used to enhance the efficacy of growth factor conjugates. PMID:28679037
  27. SHH can promote cell growth and cell osteoblastic/cementoblastic differentiation via BMP pathway PMID:27289556
  28. These studies reveal a postnatal cell population with transient Shh signaling that contributes to oligodendrogenesis during corpus callosum myelination, and gives rise to cells that continue to proliferate in adulthood and contribute to corpus callosum remyelination PMID:29045809
  29. These results support a model whereby mutations in Cdon and prenatal ethanol exposure increase Septo-optic dysplasia risk through spatiotemporal perturbations in Shh signaling activity. PMID:27935818
  30. Results report the identification of a novel long-range enhancer for Shh-Shh-brain-enhancer-6 (SBE6)-that is located 100 kb upstream of Shh and that is required for the proper induction of Shh expression during this differentiation program. PMID:27852806
  31. Hh orchestrates the balance between quiescent and activated NSCs, with important implications for understanding adult neurogenesis under normal homeostatic conditions or during injury. PMID:27666792
  32. neuroectodermal Shh expression, dorsal/ventral patterning, and amount of proliferation in the ventral neuroectoderm was not changed in Wnt1-Cre;Kif3a(fl/fl) mutants; however, tissue polarity and directional cell division were disrupted. PMID:28941984
  33. The authors find that cholesterol, an important component of the cell membrane, directly binds to Smoothened and changes its shape so that it can activate Hedgehog signaling components inside cells. PMID:27705744
  34. Embryonal tumors with multilayered rosettes (ETMRs) are characterized by a parallel activation of Shh and Wnt signaling. Co-activation of these pathways in mouse neural precursors is sufficient to induce ETMR-like tumors in vivo that resemble their human counterparts on the basis of histology and global gene-expression analyses, and that point to apical radial glia cells as the possible tumor cell of origin. PMID:28892064
  35. reactivating SHH signaling in mutant lungs rescued the tip dilation phenotype and attenuated FGF signaling. Importantly, the reduced SHH signaling activity did not appear to be caused by decreased Shh expression or protein stability; instead, biologically active form of SHH proteins were reduced in both the Ext1 mutant epithelium and surrounding wild type mesenchymal cells. PMID:28859094
  36. provide compelling evidence that epidermal YAP and Hedgehog/GLI2 signalling undergo positive regulatory interactions in the control of normal epidermal homeostasis and in basal cell carcinoma (BCC) development, which in the large majority of cases is caused by aberrant Hedgehog signalling activity PMID:28820907
  37. conditional deletion of Shh in the anterior hypothalamus results in a fully penetrant phenotype characterised by a complete arrest of (Rathke's pouch) RP development, with lack of Lhx3/Lhx4 expression in RP epithelium. PMID:28807898
  38. Shh production and Gli signaling is activated in vivo in lung, enhancing the Th2 response during a murine model of allergic asthma PMID:28235772
  39. Shh is in part responsible for the dependence of taste cell renewal on gustatory innervation, neurotrophic support of taste buds likely involves a complex set of factors. PMID:28743797
  40. GPC6 stimulates Hh signaling by binding to Hh and Ptc1 at the cilium and increasing the interaction of the receptor and ligand to promote the growth of developing long bones. PMID:28696225
  41. Results indicate that the transcription factor Gli3 (Gli3)-mutant fetal liver (FL) had increased sonic hedgehog (Shh) signaling resulting in decreased B cell development. PMID:28533268
  42. Data indicate odd-skipped related protein 1 (Osr1) as a mediator of Hedgehog (HH) signaling during foregut organogenesis. PMID:28501478
  43. direct targeting of Foxf2 by Shh signaling drives cranial neural crest cell mesenchyme proliferation during upper lip morphogenesis, and disruption of this sequence results in cleft lip. PMID:28506991
  44. Dicer1 ablation impairs Shh-induced granule neuron precursor proliferation by disrupting the expression of distinct cell cycle regulator genes that are targets of miR-17 approximately 92 cluster members. This study establishes a molecular link between miRNAs and cell cycle progression in the proliferating Granule neuron precursors during normal cerebellar development and may facilitate miRNA application in treating med... PMID:27600805
  45. Expression of Bmp4 in the ureteric mesenchyme depends on HH signaling and Foxf1, and that exogenous BMP4 rescued cell proliferation and epithelial differentiation in ureters with abrogated HH signaling or FOXF1 function. PMID:28797033
  46. A model in which SHH signaling plays both positive and negative roles in patterning and organogenesis of the thymus and parathyroids. PMID:27633995
  47. This suggests an important cross-talk between SHH and WIP1 pathways that accelerates tumorigenesis and supports WIP1 inhibition as a potential treatment strategy for MB. PMID:27086929
  48. High SHH expression is associated with Medulloblastoma. PMID:28031228
  49. sonic hedgehog signaling activity influences clonal spatial distribution of thalamic neurons. PMID:28250409
  50. Both the number of lung CD31-CD45-Sca-1+ cells and the expression levels of the Shh signaling pathway were downregulated in the lung tissues of mice with pulmonary emphysema. These cells and Shh signaling pathway are reactivated during acute adenovirus infection. PMID:28352167

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane. Golgi apparatus membrane.; [Sonic hedgehog protein N-product]: Cell membrane; Lipid-anchor.
Protein Families
Hedgehog family
Tissue Specificity
Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products