Abbreviation
Recombinant Mouse Prlr protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/mL can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.
Alternative Names
(PRL-R)
Molecular Characterization
Species
Mus musculus (Mouse)
Expression Region
20-229aa
Target Protein Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Prlr at 5 μg/ml can bind Anti-PRLR recombinant antibody (CSB-RA018727A0HU), the EC50 is 4.021-8.706 ng/mL.
Description
The extracellular ligand-binding domain of mouse prolactin receptor (aa 20–229) provides the critical region for prolactin engagement, making this construct particularly suited for ligand-binding interaction assays, competitive inhibition studies, and blocking antibody screening. Functional ELISA validation confirms robust binding activity, with immobilized Prlr at 5 μg/mL engaging an anti-PRLR recombinant antibody at an EC50 of 4.021–8.706 ng/mL, supporting its use as a reliable positive control in binding assays or as a target for therapeutic antibody epitope mapping. Mammalian cell expression preserves native glycosylation and conformational integrity of the extracellular domain, which aligns with standards expected in SPR- and BLI-based affinity characterization where proper folding directly impacts kinetic measurements. This C-terminal 10×His-tagged protein meets the quality thresholds commonly required for drug discovery screening workflows, with purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg by LAL.