Abbreviation
Recombinant Rhesus macaque CD47 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 4.473-4.933 ng/mL.
Species
Macaca mulatta (Rhesus macaque)
Expression Region
19-141aa
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 μg/ml can bind Anti-CD47 recombinant antibody (CSB-RA004940MA1HU). The EC50 is 4.473-4.933 ng/mL.
Description
CD47 functions as a "don't eat me" signal that enables tumor cells to evade phagocytosis, making it a critical target in cancer immunotherapy research. This recombinant extracellular domain (aa 19–141) expressed in mammalian cells demonstrates specific antibody binding with an EC50 of 4.473–4.933 ng/mL in functional ELISA, providing quantitative evidence of conformational integrity suitable for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation studies. The mammalian expression system supports native glycosylation and disulfide bond formation characteristic of the immunoglobulin variable-like domain, which is essential for accurate ligand-receptor interaction assays including surface plasmon resonance and biolayer interferometry. With purity exceeding 95% and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for antibody affinity characterization and serves as a positive control in binding assays evaluating anti-CD47 therapeutics.