Abbreviation
Recombinant Rhesus macaque IL2RG protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 μg/mL can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 33.73-41.04 ng/mL.
Alternative Names
Cytokine receptor common subunit gamma; Interleukin 2 receptor subunit gamma; Membrane receptor Il2rg
Species
Macaca mulatta (Rhesus macaque)
Expression Region
23-255aa
Target Protein Sequence
LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKENP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL2RG at 2 μg/ml can bind Anti-IL2RG recombinant antibody (CSB-RA011651MA1HU). The EC50 is 33.73-41.04 ng/mL.
Description
The common gamma chain (γc) is shared by receptors for IL-2, IL-4, IL-7, IL-9, IL-15, and IL-21, making it a central node in cytokine signaling networks that govern T cell development, NK cell function, and immune homeostasis. This recombinant rhesus macaque IL2RG, spanning the extracellular domain (aa 23–255) and expressed in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantifiable binding to an anti-IL2RG antibody with an EC50 of 33.73–41.04 ng/mL in functional ELISA, confirming conformational integrity suitable for ligand-receptor interaction studies and therapeutic antibody epitope mapping. The protein meets the purity and endotoxin criteria typical for competitive inhibition assays, blocking antibody screening, and SPR-based affinity characterization in cytokine receptor research, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin. Researchers investigating primate immunology or translating findings from macaque models can use this reagent as a positive control in binding assays or for validating biologics targeting the γc-dependent cytokine axis.