Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)

In Stock
Code: CSB-YP4607MOV
Size:
20ug
20ug100ug1mg
US$276
Quantity:
Express system: Yeast
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Cynomolgus monkey LY6G6D protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 3.963-7.154 ng/mL.
Target Names
LY6G6D
Uniprot NO.
Molecular Characterization
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Yeast
Expression Region
20-104aa
Target Protein Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody (CSB-RA013246MA1HU), the EC50 is 3.963-7.154 ng/mL.
Description

LY6G6D has emerged as a compelling immunotherapy target in oncology, and this cynomolgus monkey ortholog (residues 20–104, representing the full mature protein) enables critical cross-reactive antibody screening and preclinical validation studies. Binding activity is confirmed by functional ELISA, where immobilized protein at 2 μg/mL engages an anti-LY6G6D recombinant antibody with an EC50 of 3.963–7.154 ng/mL, supporting use in antibody development campaigns, epitope binning, and species cross-reactivity assessments. Yeast-based expression preserves eukaryotic folding of the LY6/uPAR domain while the N-terminal 6×His tag facilitates oriented immobilization on biosensor surfaces for kinetic binding assays. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for functional cell-based assays evaluating antibody-dependent cytotoxicity or complement activation in NHP-relevant preclinical models.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products