Abbreviation
Recombinant Cynomolgus monkey SLC39A6 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 μg/mL can bind Anti-SLC39A6 recombinant antibody (CSB-RA621669MA1HU). The EC50 is 0.8290-0.9864 ng/mL.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
21-309aa
Target Protein Sequence
LHELKSAAAFPQTTEKISPNWESGINVDLAITTRQYHLQQLFYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHEHHSDHEHHSHRNHAASGKNKRKALCPEHDSDSSGKDPRNSQGKGAHRPEHANGRRNVKDSVSTSEVTSTVYNTVSEGTHFLETIETPKLFPKDVSSSTPPSVTEKSLVSRLAGRKTNESMSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus SLC39A6 at 2 μg/ml can bind Anti-SLC39A6 recombinant antibody (CSB-RA621669MA1HU). The EC50 is 0.8290-0.9864 ng/mL.
Description
ZIP6 (SLC39A6) mediates zinc influx across cellular membranes and has been implicated in tumor progression and metastasis, making it a relevant target for cancer biology investigations. This partial extracellular domain construct (aa 21–309) demonstrates robust antibody-binding activity in functional ELISA, with an EC50 of 0.83–0.99 ng/mL when immobilized at 2 μg/mL and challenged with anti-SLC39A6 recombinant antibody, confirming that the recombinant protein retains native epitope presentation. The quantified binding kinetics support its use in antibody development workflows, including hybridoma screening, epitope mapping, and as a calibration standard in immunoassays targeting ZIP6. Produced in baculovirus-infected insect cells with a C-terminal 6xHis tag, the protein exceeds 95% purity by SDS-PAGE and contains less than 1.0 EU/μg endotoxin, satisfying the quality criteria typical for ligand-binding assays and biophysical characterization studies where low contaminant levels are essential.