Abbreviation
Recombinant Cynomolgus monkey PTH protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis PTH1R（CSB-MP018988MOV4） at 2 μg/mL can bind Macaca fascicularis PTH. The EC50 is 346.7-417.7 ng/mL.
Alternative Names
Parathyroid hormone; PTH; Parathyrin
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
32-115aa
Target Protein Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFIALGAPLAPRDAGSQRPRKKEDNILVESHEKSLGEADKADVDVLTKAKSQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis PTH1R（CSB-MP018988MOV4） at 2 μg/ml can bind Macaca fascicularis PTH. The EC50 is 346.7-417.7 ng/mL.
Description
Parathyroid hormone orchestrates calcium homeostasis through G protein–coupled receptor signaling, making authentic primate orthologs essential for translational metabolic research. This cynomolgus monkey PTH spans the complete mature sequence (residues 32–115) and demonstrates quantified receptor engagement, binding immobilized PTH1R with an EC50 of 346.7–417.7 ng/mL in functional ELISA—a result that supports its use in receptor competition assays, cAMP induction studies, and structure-function mapping of PTH–PTH1R interactions. The mammalian expression system and C-terminal hFc1 tag provide native glycosylation and extended serum half-life, features that align with standards expected in pharmacokinetic studies and in vivo models of bone metabolism or mineral ion dysregulation. Endotoxin levels below 1.0 EU/μg and purity exceeding 95% satisfy the criteria typical for cell-based signaling assays and antibody development workflows where contaminant interference must be minimized.
