Recombinant Macaca fascicularis Folate receptor alpha(FOLR1),partial (Active)

In Stock
Code: CSB-MP5002MOV
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Cynomolgus monkey FOLR1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/mL can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 2.900-3.544 ng/mL.
Target Names
FOLR1
Uniprot NO.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
Mammalian cell
Expression Region
25-233aa
Target Protein Sequence
RTARARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWKKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCPVGAACQPFHFYFPTPTVLCNEIWTYSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus FOLR1 at 2 μg/ml can bind Anti-FOLR1 recombinant antibody(CSB-RA008784MA1HU). The EC50 is 2.900-3.544 ng/mL.
Description

Folate receptor alpha serves as a validated target in antibody-drug conjugate development and tumor-targeted therapy, making conformationally authentic recombinant protein essential for screening and characterization workflows. This cynomolgus FOLR1 fragment, spanning residues 25–233 and expressed in mammalian cells to preserve native glycosylation and disulfide architecture, demonstrates quantifiable antibody-binding activity with an EC50 of 2.900–3.544 ng/mL in functional ELISA, providing a reliable basis for therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation. The low endotoxin level (< 1.0 EU/μg) and greater than 95% purity support its use in surface plasmon resonance and biolayer interferometry experiments where contaminants would compromise affinity measurements. Researchers conducting ligand-receptor interaction studies or small-molecule inhibitor screening can leverage this validated reagent as a positive control or immobilized ligand in binding assays that demand reproducible, quantitative readouts.

Customer Reviews and Q&A

 Customer Reviews

Target Background

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products