Abbreviation
Recombinant Cynomolgus monkey CLEC4C protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2 μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU). The EC50 is 5.506-6.472 ng/mL.
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Expression Region
48-212aa
Target Protein Sequence
YSKTVKRLSKLQEYQQYYPSLTCVMEGKDMEDWSCCPTPWTSFQSSCYFISTVMQSWTKSQNNCSVMGADLVVINTKEEQDFITQNLKINSAYFLGLSDPKGWRHWQWVDQTPYNKNVTFWHSGEPNSPDERCAIINFRSEEWGWNDVHCHVPQKSICKMKKIYI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CLEC4C at 2μg/mL can bind Anti-CLEC4C recombinant antibody(CSB-RA855470MA1HU),the EC50 is 5.506-6.472 ng/mL.
-
CLEC4C Recombinant Monoclonal Antibody (CSB-RA855470MA1HU) captured on Protein A Chip can bind Recombinant Human CLEC4C protein with an affinity constant of 84.8 pM as detected by MetaSPR Assay (WeSPRTM 200).
Description
CLEC4C, a C-type lectin receptor expressed on plasmacytoid dendritic cells, mediates endocytic uptake and immune signaling, making it a target of interest in antiviral immunity and autoimmune disease models. This cynomolgus macaque ortholog, spanning residues 48–212 and encompassing the extracellular carbohydrate-recognition domain, demonstrates quantifiable antibody-binding activity with an EC50 of 5.506–6.472 ng/mL in functional ELISA, providing a validated reagent for therapeutic antibody epitope mapping and competitive inhibition screening in translational primate studies. Mammalian cell expression preserves the native glycosylation and disulfide architecture critical for lectin domain folding, supporting its use in ligand-binding assays, surface plasmon resonance affinity characterization, and biolayer interferometry experiments that demand conformationally intact receptor. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg align with standards expected in antibody screening workflows and receptor-ligand interaction studies where low background and minimal inflammatory artifacts are essential.